Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|4040
Gene name
LocationContig_322:8864..9803
Strand+
Gene length (bp)939
Transcript length (bp)798
Coding sequence length (bp)798
Protein length (aa) 266

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07200 Mod_r Modifier of rudimentary (Mod(r)) protein 4.0E-24 79 252

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5366
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4040 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|529
Ophiocordyceps camponoti-floridani Ophcf2|00128
Ophiocordyceps kimflemingae Ophio5|3812
Ophiocordyceps subramaniannii Hirsu2|5326

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|4040
MSSFGHDDMDASTPPPPPPPKSGGHQAGDISSPGQQPRLPLPPPGAEAGGDGSAAVEPLPDMDAIEPDPGEKWLP
DWLKDKTTQDLAEIVASSSLLRAVTHAPQTAHSSLKSSQAALMQALKANNEQAERLSEQAEALSRARAGTQAQLL
ATRALERTWRAKQADMDRALGPTSPAALYQRTAAGVVEQAAVCHALEESFLDGGGGGGIGAQGENATGNSGAGCG
VASEREVAEWVRRYREAKVLLYQRQERKERWDAGRVGGWR*
Coding >OphauG2|4040
ATGAGCAGCTTTGGGCACGACGACATGGATGCTTCGACGCCACCGCCTCCGCCTCCGCCAAAATCTGGTGGCCAC
CAGGCGGGGGATATTAGCTCGCCTGGCCAGCAACCTCGTCTTCCCCTTCCACCGCCGGGTGCAGAGGCAGGAGGG
GATGGATCGGCGGCAGTAGAACCGCTGCCCGACATGGATGCAATTGAGCCTGATCCGGGAGAGAAGTGGTTACCA
GACTGGCTAAAGGACAAGACAACACAGGACCTAGCAGAAATTGTCGCCTCATCATCACTTTTGCGCGCAGTGACA
CACGCGCCACAGACAGCACATAGTAGCCTCAAGTCCTCACAGGCTGCCCTGATGCAGGCTCTCAAAGCCAACAAC
GAACAGGCAGAACGGCTATCCGAGCAGGCAGAAGCCCTGTCGCGGGCACGAGCAGGCACGCAAGCGCAGCTGTTG
GCGACGCGTGCCCTAGAGCGGACATGGCGCGCAAAGCAGGCCGACATGGACCGAGCGCTGGGGCCGACATCGCCA
GCAGCGCTCTACCAGCGCACGGCGGCAGGTGTAGTCGAGCAGGCGGCTGTGTGCCACGCGCTCGAGGAAAGTTTC
CTGGATGGCGGCGGCGGCGGCGGCATAGGCGCACAAGGCGAGAATGCGACGGGAAATTCGGGGGCTGGCTGTGGC
GTGGCATCAGAGAGAGAAGTGGCCGAGTGGGTTCGGCGGTACAGGGAAGCAAAGGTGTTGCTCTACCAGAGACAG
GAAAGAAAGGAGAGATGGGATGCCGGGCGAGTGGGGGGCTGGAGATGA
Transcript >OphauG2|4040
ATGAGCAGCTTTGGGCACGACGACATGGATGCTTCGACGCCACCGCCTCCGCCTCCGCCAAAATCTGGTGGCCAC
CAGGCGGGGGATATTAGCTCGCCTGGCCAGCAACCTCGTCTTCCCCTTCCACCGCCGGGTGCAGAGGCAGGAGGG
GATGGATCGGCGGCAGTAGAACCGCTGCCCGACATGGATGCAATTGAGCCTGATCCGGGAGAGAAGTGGTTACCA
GACTGGCTAAAGGACAAGACAACACAGGACCTAGCAGAAATTGTCGCCTCATCATCACTTTTGCGCGCAGTGACA
CACGCGCCACAGACAGCACATAGTAGCCTCAAGTCCTCACAGGCTGCCCTGATGCAGGCTCTCAAAGCCAACAAC
GAACAGGCAGAACGGCTATCCGAGCAGGCAGAAGCCCTGTCGCGGGCACGAGCAGGCACGCAAGCGCAGCTGTTG
GCGACGCGTGCCCTAGAGCGGACATGGCGCGCAAAGCAGGCCGACATGGACCGAGCGCTGGGGCCGACATCGCCA
GCAGCGCTCTACCAGCGCACGGCGGCAGGTGTAGTCGAGCAGGCGGCTGTGTGCCACGCGCTCGAGGAAAGTTTC
CTGGATGGCGGCGGCGGCGGCGGCATAGGCGCACAAGGCGAGAATGCGACGGGAAATTCGGGGGCTGGCTGTGGC
GTGGCATCAGAGAGAGAAGTGGCCGAGTGGGTTCGGCGGTACAGGGAAGCAAAGGTGTTGCTCTACCAGAGACAG
GAAAGAAAGGAGAGATGGGATGCCGGGCGAGTGGGGGGCTGGAGATGA
Gene >OphauG2|4040
ATGAGCAGCTTTGGGCACGACGACATGGATGCTTCGACGCCACCGCCTCCGCCTCCGCCAAAATCTGGTGGCCAC
CAGGCGGGGGATATTAGCTCGCCTGGCCAGCAACCTCGTCTTCCCCTTCCACCGCCGGGTGCAGAGGCAGGAGGG
GATGGATCGGCGGCAGTAGAACCGCTGCCCGACATGGATGCAATTGAGCCTGATCCGGGAGAGAAGTGGTTACCA
GACTGGCTAAAGGACAAGACGTGAGTGGGCTTGCAGGCAGAGTTGGGAGCAGTTGGGAGCATTTGGGAGCATTTG
GGAGAGGGCATCTTCCTCCACAGCAATGGGGTAACATGACAAGTCGTTGGGATACGAGATTTGGGGCTGACGGCA
TCATGCGACAGAACACAGGACCTAGCAGAAATTGTCGCCTCATCATCACTTTTGCGCGCAGTGACACACGCGCCA
CAGACAGCACATAGTAGCCTCAAGTCCTCACAGGCTGCCCTGATGCAGGCTCTCAAAGCCAACAACGAACAGGCA
GAACGGCTATCCGAGCAGGCAGAAGCCCTGTCGCGGGCACGAGCAGGCACGCAAGCGCAGCTGTTGGCGACGCGT
GCCCTAGAGCGGACATGGCGCGCAAAGCAGGCCGACATGGACCGAGCGCTGGGGCCGACATCGCCAGCAGCGCTC
TACCAGCGCACGGCGGCAGGTGTAGTCGAGCAGGCGGCTGTGTGCCACGCGCTCGAGGAAAGTTTCCTGGATGGC
GGCGGCGGCGGCGGCATAGGCGCACAAGGCGAGAATGCGACGGGAAATTCGGGGGCTGGCTGTGGCGTGGCATCA
GAGAGAGAAGTGGCCGAGTGGGTTCGGCGGTACAGGGAAGCAAAGGTGTTGCTCTACCAGAGACAGGAAAGAAAG
GAGAGATGGGATGCCGGGCGAGTGGGGGGCTGGAGATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail