Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|4038
Gene name
LocationContig_322:4217..4654
Strand+
Gene length (bp)437
Transcript length (bp)246
Coding sequence length (bp)246
Protein length (aa) 82

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08991 MTCP1 Mature-T-Cell Proliferation I type 1.9E-27 15 76

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|B5RTE0|CMC4_DEBHA Cx9C motif-containing protein 4, mitochondrial OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=CMC4 PE=3 SV=1 8 76 5.0E-19
sp|C5DT65|CMC4_ZYGRC Cx9C motif-containing protein 4, mitochondrial OS=Zygosaccharomyces rouxii (strain ATCC 2623 / CBS 732 / NBRC 1130 / NCYC 568 / NRRL Y-229) GN=CMC4 PE=3 SV=1 14 80 6.0E-18
sp|C5M6H7|CMC4_CANTT Cx9C motif-containing protein 4, mitochondrial OS=Candida tropicalis (strain ATCC MYA-3404 / T1) GN=CMC4 PE=3 SV=2 11 76 9.0E-18
sp|C4Y2J3|CMC4_CLAL4 Cx9C motif-containing protein 4, mitochondrial OS=Clavispora lusitaniae (strain ATCC 42720) GN=CMC4 PE=3 SV=1 16 76 1.0E-17
sp|C5E268|CMC4_LACTC Cx9C motif-containing protein 4, mitochondrial OS=Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284) GN=CMC4 PE=3 SV=1 15 76 1.0E-17
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|B5RTE0|CMC4_DEBHA Cx9C motif-containing protein 4, mitochondrial OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=CMC4 PE=3 SV=1 8 76 5.0E-19
sp|C5DT65|CMC4_ZYGRC Cx9C motif-containing protein 4, mitochondrial OS=Zygosaccharomyces rouxii (strain ATCC 2623 / CBS 732 / NBRC 1130 / NCYC 568 / NRRL Y-229) GN=CMC4 PE=3 SV=1 14 80 6.0E-18
sp|C5M6H7|CMC4_CANTT Cx9C motif-containing protein 4, mitochondrial OS=Candida tropicalis (strain ATCC MYA-3404 / T1) GN=CMC4 PE=3 SV=2 11 76 9.0E-18
sp|C4Y2J3|CMC4_CLAL4 Cx9C motif-containing protein 4, mitochondrial OS=Clavispora lusitaniae (strain ATCC 42720) GN=CMC4 PE=3 SV=1 16 76 1.0E-17
sp|C5E268|CMC4_LACTC Cx9C motif-containing protein 4, mitochondrial OS=Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284) GN=CMC4 PE=3 SV=1 15 76 1.0E-17
sp|C8ZF59|CMC4_YEAS8 Cx9C motif-containing protein 4, mitochondrial OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=CMC4 PE=3 SV=1 15 76 3.0E-17
sp|A6ZMQ6|CMC4_YEAS7 Cx9C motif-containing protein 4, mitochondrial OS=Saccharomyces cerevisiae (strain YJM789) GN=CMC4 PE=3 SV=1 15 76 3.0E-17
sp|B3LM82|CMC4_YEAS1 Cx9C motif-containing protein 4, mitochondrial OS=Saccharomyces cerevisiae (strain RM11-1a) GN=CMC4 PE=3 SV=1 15 76 3.0E-17
sp|Q3E7A9|CMC4_YEAST Cx9C motif-containing protein 4, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CMC4 PE=3 SV=1 15 76 6.0E-17
sp|C7GRF7|CMC4_YEAS2 Cx9C motif-containing protein 4, mitochondrial OS=Saccharomyces cerevisiae (strain JAY291) GN=CMC4 PE=3 SV=1 15 76 3.0E-15
sp|Q6C4R1|CMC4_YARLI Cx9C motif-containing protein 4, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=CMC4 PE=3 SV=2 15 76 3.0E-15
sp|C4YIM0|CMC4_CANAW Cx9C motif-containing protein 4, mitochondrial OS=Candida albicans (strain WO-1) GN=CMC4 PE=3 SV=1 11 65 1.0E-13
sp|A5DUN2|CMC4_LODEL Cx9C motif-containing protein 4, mitochondrial OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=CMC4 PE=3 SV=1 1 65 5.0E-12
sp|Q61908|CMC4_MOUSE Cx9C motif-containing protein 4 OS=Mus musculus GN=Cmc4 PE=2 SV=1 15 51 1.0E-06
sp|Q0VBY0|CMC4_BOVIN Cx9C motif-containing protein 4 OS=Bos taurus GN=CMC4 PE=3 SV=1 15 51 2.0E-06
sp|P56277|CMC4_HUMAN Cx9C motif-containing protein 4 OS=Homo sapiens GN=CMC4 PE=1 SV=1 15 51 4.0E-06
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4889
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4038 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|527
Ophiocordyceps camponoti-floridani Ophcf2|00130
Ophiocordyceps camponoti-rufipedis Ophun1|2960
Ophiocordyceps kimflemingae Ophio5|3809
Ophiocordyceps subramaniannii Hirsu2|1131

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|4038
MTKDSPRSDVDAQPPCHPRACAIQNCLVSNNYNEAKCQAAVRALYDCCDAFYERYGNDASTPSCPMASLLQLKMR
QLNKQN*
Coding >OphauG2|4038
ATGACAAAGGATTCGCCGAGAAGCGATGTCGACGCCCAACCGCCCTGCCACCCACGCGCATGCGCGATCCAGAAC
TGTCTAGTCTCAAACAACTACAACGAGGCCAAGTGTCAGGCAGCTGTCCGGGCCCTCTACGACTGCTGCGACGCC
TTTTATGAGCGTTACGGCAATGATGCCTCAACGCCAAGCTGTCCCATGGCGAGCCTGCTGCAACTCAAAATGCGG
CAACTAAACAAGCAAAACTAA
Transcript >OphauG2|4038
ATGACAAAGGATTCGCCGAGAAGCGATGTCGACGCCCAACCGCCCTGCCACCCACGCGCATGCGCGATCCAGAAC
TGTCTAGTCTCAAACAACTACAACGAGGCCAAGTGTCAGGCAGCTGTCCGGGCCCTCTACGACTGCTGCGACGCC
TTTTATGAGCGTTACGGCAATGATGCCTCAACGCCAAGCTGTCCCATGGCGAGCCTGCTGCAACTCAAAATGCGG
CAACTAAACAAGCAAAACTAA
Gene >OphauG2|4038
ATGGTGGGCGTGCCATTGTCGTCGTGCAAAACCAGGCCTCAGCTACTGACTGACGCGGGGACGATGCTTAGACAA
AGGATTCGCCGAGAAGCGATGTCGACGCCCAACCGCCCTGCCACCCACGCGCAGTAAGTCAGCCCCTACAGAGTA
TGGTTTGAAAAGTCTCCAACTAATCATGACGTGTGGCTAGTGCGCGATCCAGAGTAGGACCCTCCCTCCTCCAAC
TACTGAGAAGCCACGGCGTGCTAAGGTGCAGCAAATCAGACTGTCTAGTCTCAAACAACTACAACGAGGCCAAGT
GTCAGGCAGCTGTCCGGGCCCTCTACGACTGCTGCGACGCCTTTTATGAGCGTTACGGCAATGATGCCTCAACGC
CAAGCTGTCCCATGGCGAGCCTGCTGCAACTCAAAATGCGGCAACTAAACAAGCAAAACTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail