Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|4037
Gene name
LocationContig_322:3378..3760
Strand-
Gene length (bp)382
Transcript length (bp)309
Coding sequence length (bp)309
Protein length (aa) 103

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like 9.4E-20 25 90
PF00240 ubiquitin Ubiquitin family 3.3E-11 24 94

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q12306|SMT3_YEAST Ubiquitin-like protein SMT3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SMT3 PE=1 SV=1 22 98 2.0E-29
sp|O13351|PMT3_SCHPO Ubiquitin-like protein pmt3/smt3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pmt3 PE=1 SV=2 11 102 4.0E-27
sp|P55857|SUMO1_ORYSJ Small ubiquitin-related modifier 1 OS=Oryza sativa subsp. japonica GN=SUMO1 PE=1 SV=1 9 98 5.0E-24
sp|Q9FLP6|SUMO2_ARATH Small ubiquitin-related modifier 2 OS=Arabidopsis thaliana GN=SUMO2 PE=1 SV=1 9 97 1.0E-22
sp|P61959|SUMO2_RAT Small ubiquitin-related modifier 2 OS=Rattus norvegicus GN=Sumo2 PE=1 SV=1 19 99 2.0E-22
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q12306|SMT3_YEAST Ubiquitin-like protein SMT3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SMT3 PE=1 SV=1 22 98 2.0E-29
sp|O13351|PMT3_SCHPO Ubiquitin-like protein pmt3/smt3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pmt3 PE=1 SV=2 11 102 4.0E-27
sp|P55857|SUMO1_ORYSJ Small ubiquitin-related modifier 1 OS=Oryza sativa subsp. japonica GN=SUMO1 PE=1 SV=1 9 98 5.0E-24
sp|Q9FLP6|SUMO2_ARATH Small ubiquitin-related modifier 2 OS=Arabidopsis thaliana GN=SUMO2 PE=1 SV=1 9 97 1.0E-22
sp|P61959|SUMO2_RAT Small ubiquitin-related modifier 2 OS=Rattus norvegicus GN=Sumo2 PE=1 SV=1 19 99 2.0E-22
sp|P61958|SUMO2_PIG Small ubiquitin-related modifier 2 OS=Sus scrofa GN=SUMO2 PE=3 SV=1 19 99 2.0E-22
sp|P61957|SUMO2_MOUSE Small ubiquitin-related modifier 2 OS=Mus musculus GN=Sumo2 PE=1 SV=1 19 99 2.0E-22
sp|Q2PFW2|SUMO2_MACFA Small ubiquitin-related modifier 2 OS=Macaca fascicularis GN=SUMO2 PE=3 SV=1 19 99 2.0E-22
sp|P61956|SUMO2_HUMAN Small ubiquitin-related modifier 2 OS=Homo sapiens GN=SUMO2 PE=1 SV=3 19 99 2.0E-22
sp|Q6LDZ8|SUMO2_CRIGR Small ubiquitin-related modifier 2 OS=Cricetulus griseus GN=SUMO2 PE=3 SV=1 19 99 2.0E-22
sp|Q5ZJM9|SUMO2_CHICK Small ubiquitin-related modifier 2 OS=Gallus gallus GN=SUMO2 PE=3 SV=1 19 99 2.0E-22
sp|P61955|SUMO2_BOVIN Small ubiquitin-related modifier 2 OS=Bos taurus GN=SUMO2 PE=3 SV=1 19 99 2.0E-22
sp|Q6GPW2|SMO2B_XENLA Small ubiquitin-related modifier 2-B OS=Xenopus laevis GN=sumo2-b PE=3 SV=1 19 99 3.0E-22
sp|Q7ZTK7|SMO2A_XENLA Small ubiquitin-related modifier 2-A OS=Xenopus laevis GN=sumo2-a PE=3 SV=1 19 98 6.0E-22
sp|P55852|SUMO1_ARATH Small ubiquitin-related modifier 1 OS=Arabidopsis thaliana GN=SUMO1 PE=1 SV=2 22 92 9.0E-22
sp|Q28H04|SUMO2_XENTR Small ubiquitin-related modifier 2 OS=Xenopus tropicalis GN=sumo2 PE=3 SV=1 19 98 9.0E-22
sp|Q6DHL4|SUMO2_DANRE Small ubiquitin-related modifier 2 OS=Danio rerio GN=sumo2 PE=3 SV=1 19 100 1.0E-21
sp|Q17QV3|SUMO3_BOVIN Small ubiquitin-related modifier 3 OS=Bos taurus GN=SUMO3 PE=3 SV=1 20 100 5.0E-21
sp|P55854|SUMO3_HUMAN Small ubiquitin-related modifier 3 OS=Homo sapiens GN=SUMO3 PE=1 SV=2 20 98 6.0E-21
sp|Q9Z172|SUMO3_MOUSE Small ubiquitin-related modifier 3 OS=Mus musculus GN=Sumo3 PE=1 SV=1 20 97 8.0E-21
sp|Q5XIF4|SUMO3_RAT Small ubiquitin-related modifier 3 OS=Rattus norvegicus GN=Sumo3 PE=3 SV=1 20 97 8.0E-21
sp|P55853|SUMO_CAEEL Small ubiquitin-related modifier OS=Caenorhabditis elegans GN=smo-1 PE=1 SV=1 16 97 9.0E-21
sp|Q6DI05|SUMO3_DANRE Small ubiquitin-related modifier 3 OS=Danio rerio GN=sumo3 PE=3 SV=1 20 97 2.0E-20
sp|Q6DK72|SUMO3_XENTR Small ubiquitin-related modifier 3 OS=Xenopus tropicalis GN=sumo3 PE=3 SV=1 20 97 2.0E-20
sp|Q7SZ22|SUMO3_XENLA Small ubiquitin-related modifier 3 OS=Xenopus laevis GN=sumo3 PE=3 SV=1 20 97 2.0E-20
sp|Q6NV25|SMO3L_DANRE Small ubiquitin-related modifier 3-like OS=Danio rerio GN=sumo3l PE=3 SV=1 20 97 3.0E-20
sp|Q5ZHQ1|SUMO3_CHICK Small ubiquitin-related modifier 3 OS=Gallus gallus GN=SUMO3 PE=3 SV=1 20 97 3.0E-20
sp|Q5I0H3|SUMO1_RAT Small ubiquitin-related modifier 1 OS=Rattus norvegicus GN=Sumo1 PE=1 SV=1 11 97 4.0E-19
sp|Q5R6J4|SUMO1_PONAB Small ubiquitin-related modifier 1 OS=Pongo abelii GN=SUMO1 PE=3 SV=1 11 97 4.0E-19
sp|A7WLH8|SUMO1_PIG Small ubiquitin-related modifier 1 OS=Sus scrofa GN=SUMO1 PE=3 SV=1 11 97 4.0E-19
sp|P63166|SUMO1_MOUSE Small ubiquitin-related modifier 1 OS=Mus musculus GN=Sumo1 PE=1 SV=1 11 97 4.0E-19
sp|P63165|SUMO1_HUMAN Small ubiquitin-related modifier 1 OS=Homo sapiens GN=SUMO1 PE=1 SV=1 11 97 4.0E-19
sp|Q5E9D1|SUMO1_BOVIN Small ubiquitin-related modifier 1 OS=Bos taurus GN=SUMO1 PE=3 SV=1 11 97 4.0E-19
sp|Q2EF74|SUMO1_ICTTR Small ubiquitin-related modifier 1 OS=Ictidomys tridecemlineatus GN=SUMO1 PE=3 SV=1 11 97 4.0E-19
sp|A7WLI0|SUMO4_PIG Small ubiquitin-related modifier 4 OS=Sus scrofa GN=SUMO4 PE=1 SV=1 19 99 2.0E-18
sp|Q9MZD5|SUMO1_CERNI Small ubiquitin-related modifier 1 OS=Cervus nippon GN=SUMO1 PE=3 SV=1 11 97 2.0E-18
sp|Q8QGH2|SUMO1_CHICK Small ubiquitin-related modifier 1 OS=Gallus gallus GN=SUMO1 PE=3 SV=1 21 97 2.0E-18
sp|Q7SZR5|SUMO1_DANRE Small ubiquitin-related modifier 1 OS=Danio rerio GN=sumo1 PE=3 SV=1 19 98 5.0E-18
sp|Q6EEV6|SUMO4_HUMAN Small ubiquitin-related modifier 4 OS=Homo sapiens GN=SUMO4 PE=1 SV=2 19 99 7.0E-18
sp|Q6DEP7|SUMO1_XENTR Small ubiquitin-related modifier 1 OS=Xenopus tropicalis GN=sumo1 PE=3 SV=1 21 97 8.0E-18
sp|Q5EAX4|SMO1B_XENLA Small ubiquitin-related modifier 1-B OS=Xenopus laevis GN=sumo1-b PE=3 SV=1 21 97 8.0E-18
sp|Q9PT08|SUMO1_ONCMY Small ubiquitin-related modifier 1 OS=Oncorhynchus mykiss GN=sumo1 PE=3 SV=1 19 98 8.0E-18
sp|O57686|SMO1A_XENLA Small ubiquitin-related modifier 1-A OS=Xenopus laevis GN=sumo1-a PE=1 SV=1 21 97 5.0E-16
sp|B3H5R8|SUMO8_ARATH Putative small ubiquitin-related modifier 8 OS=Arabidopsis thaliana GN=SUMO8 PE=1 SV=1 20 97 2.0E-15
sp|Q3E8A8|SUMO7_ARATH Putative small ubiquitin-related modifier 7 OS=Arabidopsis thaliana GN=SUMO7 PE=1 SV=2 22 97 1.0E-13
sp|Q9FLP5|SUMO3_ARATH Small ubiquitin-related modifier 3 OS=Arabidopsis thaliana GN=SUMO3 PE=1 SV=1 22 97 2.0E-13
sp|Q9FKC5|SUMO4_ARATH Putative small ubiquitin-related modifier 4 OS=Arabidopsis thaliana GN=SUMO4 PE=1 SV=1 22 89 1.0E-09
sp|Q8VZI7|SUMO5_ARATH Small ubiquitin-related modifier 5 OS=Arabidopsis thaliana GN=SUMO5 PE=1 SV=1 10 97 3.0E-07
sp|Q9FKC6|SUMO6_ARATH Putative small ubiquitin-related modifier 6 OS=Arabidopsis thaliana GN=SUMO6 PE=1 SV=1 23 97 1.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4890
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4037 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|526
Ophiocordyceps camponoti-floridani Ophcf2|00131
Ophiocordyceps camponoti-rufipedis Ophun1|2959
Ophiocordyceps kimflemingae Ophio5|3808
Ophiocordyceps subramaniannii Hirsu2|1132

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|4037
MTTEDGGQALTEQMTAPANSEHLNIKVTDSSNEIFFKIKRSTKLEKLMNAFCERQGKAMASVRFLFDGTRVQPTD
TPDALDMADGDTLEVHQEQVGGCHLEC*
Coding >OphauG2|4037
ATGACTACTGAAGACGGTGGCCAAGCTCTGACGGAGCAAATGACAGCGCCAGCAAACTCGGAGCACTTAAACATC
AAGGTCACGGACAGCAGCAATGAAATCTTCTTCAAGATAAAGCGATCCACCAAACTAGAGAAGCTCATGAATGCC
TTTTGCGAGAGACAGGGCAAGGCAATGGCTTCGGTTCGATTTCTCTTTGACGGCACACGTGTCCAGCCAACTGAC
ACGCCCGACGCGCTGGATATGGCCGACGGGGACACTCTAGAGGTGCACCAGGAGCAGGTTGGCGGTTGCCACCTG
GAGTGCTAA
Transcript >OphauG2|4037
ATGACTACTGAAGACGGTGGCCAAGCTCTGACGGAGCAAATGACAGCGCCAGCAAACTCGGAGCACTTAAACATC
AAGGTCACGGACAGCAGCAATGAAATCTTCTTCAAGATAAAGCGATCCACCAAACTAGAGAAGCTCATGAATGCC
TTTTGCGAGAGACAGGGCAAGGCAATGGCTTCGGTTCGATTTCTCTTTGACGGCACACGTGTCCAGCCAACTGAC
ACGCCCGACGCGCTGGATATGGCCGACGGGGACACTCTAGAGGTGCACCAGGAGCAGGTTGGCGGTTGCCACCTG
GAGTGCTAA
Gene >OphauG2|4037
ATGACTACTGAAGACGGTGGCCAAGCTCTGACGGAGCAAATGACAGCGCCAGCAAACTCGGAGCACTTAAACATC
AAGGTCACGGACAGCAGCAATGAAATCTTCTTCAAGATAAAGCGATCCACCAAACTAGAGAAGCTCATGAATGCC
TTTTGCGAGAGACAGGGCAAGGCAATGGCTTCGGTTCGATTTCTCTTTGACGGCACACGTGTCCAGCCAACTGAC
ACGCCCGACGCGGTACGCATGTCTTGTCTTTGTGTCCACAAACACTGCTGATGAAGTTTTTTTTTTTTTTGCTTG
CGACGTATAGCTGGATATGGCCGACGGGGACACTCTAGAGGTGCACCAGGAGCAGGTTGGCGGTTGCCACCTGGA
GTGCTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail