Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|4035
Gene name
LocationContig_321:14679..18275
Strand+
Gene length (bp)3596
Transcript length (bp)3534
Coding sequence length (bp)3534
Protein length (aa) 1178

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02141 DENN DENN (AEX-3) domain 6.9E-58 464 661
PF03455 dDENN dDENN domain 4.6E-17 1003 1052
PF03456 uDENN uDENN domain 1.7E-15 291 357
PF03107 C1_2 C1 domain 7.3E-06 910 951

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7Q7|DENN_SCHPO DENN domain-containing protein C297.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC297.05 PE=1 SV=1 266 793 1.0E-93
sp|O95248|MTMR5_HUMAN Myotubularin-related protein 5 OS=Homo sapiens GN=SBF1 PE=1 SV=3 507 702 1.0E-17
sp|Q6ZPE2|MTMR5_MOUSE Myotubularin-related protein 5 OS=Mus musculus GN=Sbf1 PE=1 SV=2 507 702 2.0E-17
sp|Q91VV4|DEN2D_MOUSE DENN domain-containing protein 2D OS=Mus musculus GN=Dennd2d PE=1 SV=1 560 663 7.0E-15
sp|Q9H6A0|DEN2D_HUMAN DENN domain-containing protein 2D OS=Homo sapiens GN=DENND2D PE=1 SV=2 560 663 9.0E-15
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7Q7|DENN_SCHPO DENN domain-containing protein C297.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC297.05 PE=1 SV=1 266 793 1.0E-93
sp|O95248|MTMR5_HUMAN Myotubularin-related protein 5 OS=Homo sapiens GN=SBF1 PE=1 SV=3 507 702 1.0E-17
sp|Q6ZPE2|MTMR5_MOUSE Myotubularin-related protein 5 OS=Mus musculus GN=Sbf1 PE=1 SV=2 507 702 2.0E-17
sp|Q91VV4|DEN2D_MOUSE DENN domain-containing protein 2D OS=Mus musculus GN=Dennd2d PE=1 SV=1 560 663 7.0E-15
sp|Q9H6A0|DEN2D_HUMAN DENN domain-containing protein 2D OS=Homo sapiens GN=DENND2D PE=1 SV=2 560 663 9.0E-15
sp|Q86WG5|MTMRD_HUMAN Myotubularin-related protein 13 OS=Homo sapiens GN=SBF2 PE=1 SV=1 507 702 1.0E-14
sp|Q6NTN5|MTMRD_XENLA Myotubularin-related protein 13 OS=Xenopus laevis GN=sbf2 PE=2 SV=1 514 673 6.0E-14
sp|A2RSQ0|DEN5B_MOUSE DENN domain-containing protein 5B OS=Mus musculus GN=Dennd5b PE=1 SV=2 513 707 7.0E-14
sp|Q6ZUT9|DEN5B_HUMAN DENN domain-containing protein 5B OS=Homo sapiens GN=DENND5B PE=1 SV=2 513 674 1.0E-13
sp|Q9Y7Q7|DENN_SCHPO DENN domain-containing protein C297.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC297.05 PE=1 SV=1 898 1064 3.0E-13
sp|Q7Z401|MYCPP_HUMAN C-myc promoter-binding protein OS=Homo sapiens GN=DENND4A PE=1 SV=2 564 685 6.0E-13
sp|Q6NXD8|DEN5B_DANRE DENN domain-containing protein 5B OS=Danio rerio GN=dennd5b PE=2 SV=2 566 664 1.0E-12
sp|O75064|DEN4B_HUMAN DENN domain-containing protein 4B OS=Homo sapiens GN=DENND4B PE=1 SV=4 565 684 1.0E-12
sp|Q6IQ26|DEN5A_HUMAN DENN domain-containing protein 5A OS=Homo sapiens GN=DENND5A PE=1 SV=2 513 702 2.0E-12
sp|Q6PAL8|DEN5A_MOUSE DENN domain-containing protein 5A OS=Mus musculus GN=Dennd5a PE=1 SV=1 513 702 2.0E-12
sp|Q6P3S1|DEN1B_HUMAN DENN domain-containing protein 1B OS=Homo sapiens GN=DENND1B PE=1 SV=1 554 665 4.0E-12
sp|Q8IV53|DEN1C_HUMAN DENN domain-containing protein 1C OS=Homo sapiens GN=DENND1C PE=1 SV=1 561 666 5.0E-12
sp|P78524|ST5_HUMAN Suppression of tumorigenicity 5 protein OS=Homo sapiens GN=ST5 PE=1 SV=3 560 661 8.0E-12
sp|Q8RXA7|SCD1_ARATH DENN domain and WD repeat-containing protein SCD1 OS=Arabidopsis thaliana GN=SCD1 PE=1 SV=1 508 673 8.0E-12
sp|Q5VZ89|DEN4C_HUMAN DENN domain-containing protein 4C OS=Homo sapiens GN=DENND4C PE=1 SV=2 565 690 8.0E-12
sp|Q924W7|ST5_MOUSE Suppression of tumorigenicity 5 protein OS=Mus musculus GN=St5 PE=1 SV=1 560 661 1.0E-11
sp|Q3U1T9|DEN1B_MOUSE DENN domain-containing protein 1B OS=Mus musculus GN=Dennd1b PE=1 SV=2 554 665 1.0E-11
sp|Q8TEH3|DEN1A_HUMAN DENN domain-containing protein 1A OS=Homo sapiens GN=DENND1A PE=1 SV=2 554 664 1.0E-11
sp|Q8K382|DEN1A_MOUSE DENN domain-containing protein 1A OS=Mus musculus GN=Dennd1a PE=1 SV=2 554 664 2.0E-11
sp|Q8CFK6|DEN1C_MOUSE DENN domain-containing protein 1C OS=Mus musculus GN=Dennd1c PE=1 SV=1 561 664 4.0E-11
sp|Q68F67|DEN1A_XENLA DENN domain-containing protein 1A OS=Xenopus laevis GN=dennd1a PE=2 SV=1 554 664 1.0E-10
sp|Q68D51|DEN2C_HUMAN DENN domain-containing protein 2C OS=Homo sapiens GN=DENND2C PE=1 SV=2 560 685 1.0E-10
sp|Q3U1Y4|DEN4B_MOUSE DENN domain-containing protein 4B OS=Mus musculus GN=Dennd4b PE=1 SV=2 565 684 1.0E-10
sp|Q9ULE3|DEN2A_HUMAN DENN domain-containing protein 2A OS=Homo sapiens GN=DENND2A PE=2 SV=4 560 635 3.0E-10
sp|Q8C4S8|DEN2A_MOUSE DENN domain-containing protein 2A OS=Mus musculus GN=Dennd2a PE=1 SV=1 560 635 4.0E-10
sp|A6H8H2|DEN4C_MOUSE DENN domain-containing protein 4C OS=Mus musculus GN=Dennd4c PE=1 SV=1 564 663 9.0E-10
sp|Q6P9P8|DEN2C_MOUSE DENN domain-containing protein 2C OS=Mus musculus GN=Dennd2c PE=1 SV=1 560 685 2.0E-09
sp|A2RT67|DEND3_MOUSE DENN domain-containing protein 3 OS=Mus musculus GN=Dennd3 PE=1 SV=2 560 666 6.0E-08
sp|A2RUS2|DEND3_HUMAN DENN domain-containing protein 3 OS=Homo sapiens GN=DENND3 PE=1 SV=2 572 663 2.0E-07
sp|Q80U28|MADD_MOUSE MAP kinase-activating death domain protein OS=Mus musculus GN=Madd PE=1 SV=2 496 673 9.0E-06
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2708
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4035 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|3253
Ophiocordyceps camponoti-floridani Ophcf2|06665
Ophiocordyceps camponoti-rufipedis Ophun1|6031
Ophiocordyceps kimflemingae Ophio5|6207
Ophiocordyceps subramaniannii Hirsu2|4224

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|4035
MDNSASPLADYFWIAGVEAISYDDDVLPVSLPVDSTINEDGEPDDSRMHSGQPKLNAARHSRQNSANRLSKTSCD
GRFSMATFDDREGTTKSNRSSATIKPSKTSDSNGSLNGSSNGHANGNASAANAPATPTDAPPPGHFDFDTALVKF
AAERETFLQDLSFTAGAKTQSRPPMVNPRAERIRADDTPPSGRMSPLKSIKGSIRRKISFRDMNSMRKQPASARQ
SVASRAGLSTASSVQQLAWDHCIDIQGPPASIRTAKRLSNYNSVIPPPEPLNMDPDMHPLKRRFEPVLLDRYPPK
TATDEIARRGKFPDYVPMFAFPNDIQIVSSDDRPRSTWHGFTMTAEDNSKLYGITIIVWVALTADVADDVETKCE
QWRQNHMSNEERELAASLGVRLAGERIHLSQLLSRLPAMASGSVARDELEDEIGLVEEKITLMTDMLRPLRHGAA
SKIEGLTAGESGLWIPRAYGILGRDPANMAFWKEWLKAIVVPMTDGSVLRVPPSSPVKGLWQPLERYVVNLCTEA
VSPLGSKTQVELVVRELRLYARKEGPNELPGSRTVDVYALLRSLSLENVVALFEYAMSESRIIFLSSHTSMLHLA
CHGLASLLYPLKWASIFIPVLPARLISALEAPCPYIIGVERRYERIELPDDDYILVDLDKDTIDATSQPHRLPRQ
HRRKLMSLLQIAAPHTLRLGVAVGPPPYAIESFPYDSFSSENGSIFTASPRRAMLAKWVSQNSSTFGEATPPDDM
HAPVFNAFTVSTTDPARSDRPGTSKSSRTSPQSSVSPASTQFPPMPNTPLSRSDSGFALTATLREKRSGHFGEDK
GRRSSSFGLDRMHHQQQPPPRPAGALLNGHQANASISGFSVDSHQALSVGYAPSTYAQSTLAASTIMPSMQIQPV
HNTDTTMWVEGHCLTLKPNDATSTCTVCDDKPDGDAMYQCAACTIMAHARCLGQVSLVCPAAFDADRVRAAFVRC
MASLLYTYRKHLARPSKQQRSNGQLYAFDMEAFIKSLPHEQQDYARMLRDTQAFNEFIHQRETTPPTDPSIRLFD
EIIAAKRARGRPGLSSGLSRLSTIRASHGASTNAWHMPPPARPLATKATSFLSDTSEHIWRTASVPPAKAHFPGE
YRSVVTRIPSRLDRSLMREPRSIHGVPRPEQRGLRVVPRKQVPSMLGSTPPP*
Coding >OphauG2|4035
ATGGACAACTCGGCGTCGCCTCTGGCCGATTACTTCTGGATCGCCGGCGTAGAAGCCATTTCATACGACGATGAC
GTGCTGCCCGTAAGCCTGCCCGTCGACTCGACCATTAACGAAGACGGCGAGCCGGATGACAGCCGCATGCACTCG
GGCCAACCAAAGCTGAATGCTGCACGCCACTCGCGCCAAAACTCGGCAAACCGCCTCTCCAAGACGTCGTGCGAT
GGCCGCTTCTCCATGGCCACCTTTGACGACCGCGAAGGCACCACCAAGAGCAACCGCAGCAGCGCCACCATCAAG
CCTTCCAAGACGTCGGACAGCAACGGCAGCCTCAATGGCAGCTCCAACGGCCACGCCAATGGCAATGCCTCTGCC
GCTAATGCACCCGCCACACCCACAGACGCGCCGCCCCCGGGCCACTTTGACTTTGACACCGCCTTGGTCAAGTTT
GCTGCAGAGCGCGAAACCTTTCTCCAAGACCTCTCCTTTACAGCCGGCGCCAAGACGCAGTCCCGCCCGCCCATG
GTGAACCCCAGGGCCGAGCGCATCCGCGCCGACGACACGCCTCCCAGCGGGCGAATGAGCCCTCTCAAGAGCATC
AAGGGCAGCATCCGCCGCAAAATCAGCTTTAGAGACATGAACAGCATGCGCAAGCAGCCCGCGTCGGCCCGCCAG
AGTGTCGCTAGCAGAGCAGGTCTGTCCACAGCTTCTAGTGTGCAACAGCTTGCATGGGACCACTGTATTGACATT
CAGGGTCCACCAGCCTCTATCCGCACCGCAAAGCGACTCAGCAACTACAACTCTGTCATCCCACCCCCCGAGCCC
CTCAACATGGATCCCGACATGCATCCTCTCAAGCGGAGATTTGAGCCCGTCTTGCTCGACCGATACCCCCCCAAG
ACTGCCACGGACGAGATTGCCCGGCGCGGCAAGTTTCCCGACTATGTGCCCATGTTTGCCTTTCCCAACGACATT
CAGATTGTCTCGTCGGACGACCGGCCACGCTCCACATGGCACGGCTTTACCATGACTGCCGAAGACAACTCCAAG
CTCTACGGCATCACCATTATTGTGTGGGTAGCCCTGACGGCCGACGTGGCGGACGATGTGGAAACAAAGTGCGAG
CAGTGGCGGCAAAACCACATGTCGAATGAAGAGCGCGAGTTGGCTGCCAGTCTGGGCGTGCGCCTGGCGGGCGAA
CGCATACACTTGTCACAGCTGCTGTCGAGGCTGCCGGCCATGGCGTCTGGGTCGGTGGCTCGCGACGAGCTCGAA
GACGAGATTGGTCTGGTGGAGGAAAAGATTACGCTCATGACTGACATGCTCCGGCCGCTGCGGCACGGCGCGGCG
TCCAAGATTGAAGGGCTGACGGCTGGCGAGAGCGGGCTGTGGATTCCCCGGGCCTATGGCATCCTTGGACGGGAC
CCGGCCAACATGGCCTTTTGGAAGGAGTGGCTCAAGGCCATTGTGGTGCCCATGACGGACGGCAGCGTGCTGCGG
GTGCCGCCCAGCTCGCCGGTCAAGGGGCTGTGGCAGCCTCTGGAGCGCTACGTGGTCAACCTGTGCACCGAGGCG
GTCAGTCCGCTGGGGTCCAAGACGCAGGTGGAGCTGGTGGTGAGAGAGCTGAGGCTGTATGCGCGCAAGGAGGGC
CCCAATGAGCTGCCGGGCTCGCGGACGGTGGATGTGTATGCGCTGCTGCGCAGCCTCTCGCTGGAGAACGTGGTG
GCGCTGTTTGAGTACGCCATGTCTGAGTCCCGCATCATTTTCTTGTCGTCGCACACGAGCATGCTGCATCTGGCC
TGCCACGGCCTGGCCAGCCTGCTGTATCCCCTCAAGTGGGCCAGCATCTTCATCCCGGTGCTGCCGGCGCGGCTC
ATCTCGGCCCTCGAGGCGCCCTGCCCCTACATCATTGGCGTGGAGCGGCGATATGAGCGCATCGAGCTGCCCGAC
GACGACTACATCTTGGTGGACCTGGACAAGGACACGATTGACGCCACGTCGCAGCCGCACCGCCTCCCGCGACAG
CACCGCCGCAAGCTCATGTCGCTGCTCCAGATTGCCGCGCCGCACACGCTGCGCCTGGGCGTGGCGGTTGGGCCG
CCGCCGTACGCCATTGAGTCGTTTCCCTACGACTCCTTTTCGTCGGAGAACGGGTCCATCTTCACCGCGTCGCCG
CGCCGCGCCATGCTGGCCAAGTGGGTGTCGCAAAACTCGTCCACCTTTGGCGAGGCGACGCCGCCCGACGACATG
CACGCCCCCGTCTTCAACGCCTTCACCGTGTCCACCACGGACCCTGCACGCAGCGACCGCCCGGGCACCAGCAAG
TCGAGCCGCACCAGCCCGCAGTCGTCGGTGTCGCCCGCGTCGACCCAGTTCCCGCCCATGCCCAACACGCCGCTG
TCGCGCAGCGACTCGGGCTTTGCGCTGACGGCAACGCTGCGCGAGAAGCGGTCGGGGCACTTTGGCGAGGACAAG
GGCCGCCGCAGCTCGTCGTTTGGCCTGGACCGCATGCACCACCAGCAGCAGCCCCCTCCCCGCCCCGCCGGCGCA
TTGCTCAACGGCCACCAGGCCAATGCCTCCATCTCGGGCTTTTCCGTCGACTCGCACCAGGCCCTCAGCGTCGGC
TACGCGCCCTCGACGTATGCCCAGTCGACCCTGGCCGCCTCCACCATTATGCCCAGCATGCAGATCCAGCCCGTC
CACAACACCGACACCACCATGTGGGTCGAGGGCCACTGCCTGACGCTCAAGCCCAACGACGCCACGTCGACGTGC
ACCGTTTGCGACGACAAGCCCGACGGCGACGCCATGTACCAGTGCGCCGCCTGCACCATCATGGCCCACGCCCGC
TGCCTGGGCCAGGTGTCGCTCGTCTGTCCCGCCGCCTTTGACGCCGACCGCGTGCGCGCCGCCTTTGTGCGCTGC
ATGGCGAGCCTGCTGTATACCTACCGCAAGCACCTGGCGCGCCCGTCCAAGCAGCAGCGGAGCAACGGCCAGCTG
TATGCCTTTGACATGGAGGCCTTTATCAAGAGCCTGCCCCATGAGCAGCAAGACTATGCCCGCATGCTGCGCGAC
ACCCAGGCCTTCAACGAGTTTATCCACCAGCGCGAGACGACGCCTCCCACCGACCCCTCGATCCGCCTCTTTGAC
GAAATCATTGCCGCCAAGAGGGCCCGCGGCCGCCCTGGCCTCTCGTCGGGCCTGTCGCGTCTGTCCACCATTCGC
GCCTCTCACGGCGCCTCCACCAATGCCTGGCACATGCCTCCCCCCGCCCGGCCCCTCGCCACCAAGGCAACGAGC
TTCTTGTCCGACACGTCGGAGCACATTTGGCGCACCGCGTCGGTGCCGCCCGCAAAGGCACACTTCCCCGGCGAG
TACCGCTCCGTCGTGACGCGCATCCCCTCGCGCCTCGACCGCTCTCTGATGCGCGAGCCGCGCTCCATCCACGGC
GTCCCGCGGCCCGAGCAGCGCGGCCTGCGCGTCGTGCCTCGCAAGCAGGTGCCCAGCATGCTGGGCTCTACCCCT
CCGCCCTAG
Transcript >OphauG2|4035
ATGGACAACTCGGCGTCGCCTCTGGCCGATTACTTCTGGATCGCCGGCGTAGAAGCCATTTCATACGACGATGAC
GTGCTGCCCGTAAGCCTGCCCGTCGACTCGACCATTAACGAAGACGGCGAGCCGGATGACAGCCGCATGCACTCG
GGCCAACCAAAGCTGAATGCTGCACGCCACTCGCGCCAAAACTCGGCAAACCGCCTCTCCAAGACGTCGTGCGAT
GGCCGCTTCTCCATGGCCACCTTTGACGACCGCGAAGGCACCACCAAGAGCAACCGCAGCAGCGCCACCATCAAG
CCTTCCAAGACGTCGGACAGCAACGGCAGCCTCAATGGCAGCTCCAACGGCCACGCCAATGGCAATGCCTCTGCC
GCTAATGCACCCGCCACACCCACAGACGCGCCGCCCCCGGGCCACTTTGACTTTGACACCGCCTTGGTCAAGTTT
GCTGCAGAGCGCGAAACCTTTCTCCAAGACCTCTCCTTTACAGCCGGCGCCAAGACGCAGTCCCGCCCGCCCATG
GTGAACCCCAGGGCCGAGCGCATCCGCGCCGACGACACGCCTCCCAGCGGGCGAATGAGCCCTCTCAAGAGCATC
AAGGGCAGCATCCGCCGCAAAATCAGCTTTAGAGACATGAACAGCATGCGCAAGCAGCCCGCGTCGGCCCGCCAG
AGTGTCGCTAGCAGAGCAGGTCTGTCCACAGCTTCTAGTGTGCAACAGCTTGCATGGGACCACTGTATTGACATT
CAGGGTCCACCAGCCTCTATCCGCACCGCAAAGCGACTCAGCAACTACAACTCTGTCATCCCACCCCCCGAGCCC
CTCAACATGGATCCCGACATGCATCCTCTCAAGCGGAGATTTGAGCCCGTCTTGCTCGACCGATACCCCCCCAAG
ACTGCCACGGACGAGATTGCCCGGCGCGGCAAGTTTCCCGACTATGTGCCCATGTTTGCCTTTCCCAACGACATT
CAGATTGTCTCGTCGGACGACCGGCCACGCTCCACATGGCACGGCTTTACCATGACTGCCGAAGACAACTCCAAG
CTCTACGGCATCACCATTATTGTGTGGGTAGCCCTGACGGCCGACGTGGCGGACGATGTGGAAACAAAGTGCGAG
CAGTGGCGGCAAAACCACATGTCGAATGAAGAGCGCGAGTTGGCTGCCAGTCTGGGCGTGCGCCTGGCGGGCGAA
CGCATACACTTGTCACAGCTGCTGTCGAGGCTGCCGGCCATGGCGTCTGGGTCGGTGGCTCGCGACGAGCTCGAA
GACGAGATTGGTCTGGTGGAGGAAAAGATTACGCTCATGACTGACATGCTCCGGCCGCTGCGGCACGGCGCGGCG
TCCAAGATTGAAGGGCTGACGGCTGGCGAGAGCGGGCTGTGGATTCCCCGGGCCTATGGCATCCTTGGACGGGAC
CCGGCCAACATGGCCTTTTGGAAGGAGTGGCTCAAGGCCATTGTGGTGCCCATGACGGACGGCAGCGTGCTGCGG
GTGCCGCCCAGCTCGCCGGTCAAGGGGCTGTGGCAGCCTCTGGAGCGCTACGTGGTCAACCTGTGCACCGAGGCG
GTCAGTCCGCTGGGGTCCAAGACGCAGGTGGAGCTGGTGGTGAGAGAGCTGAGGCTGTATGCGCGCAAGGAGGGC
CCCAATGAGCTGCCGGGCTCGCGGACGGTGGATGTGTATGCGCTGCTGCGCAGCCTCTCGCTGGAGAACGTGGTG
GCGCTGTTTGAGTACGCCATGTCTGAGTCCCGCATCATTTTCTTGTCGTCGCACACGAGCATGCTGCATCTGGCC
TGCCACGGCCTGGCCAGCCTGCTGTATCCCCTCAAGTGGGCCAGCATCTTCATCCCGGTGCTGCCGGCGCGGCTC
ATCTCGGCCCTCGAGGCGCCCTGCCCCTACATCATTGGCGTGGAGCGGCGATATGAGCGCATCGAGCTGCCCGAC
GACGACTACATCTTGGTGGACCTGGACAAGGACACGATTGACGCCACGTCGCAGCCGCACCGCCTCCCGCGACAG
CACCGCCGCAAGCTCATGTCGCTGCTCCAGATTGCCGCGCCGCACACGCTGCGCCTGGGCGTGGCGGTTGGGCCG
CCGCCGTACGCCATTGAGTCGTTTCCCTACGACTCCTTTTCGTCGGAGAACGGGTCCATCTTCACCGCGTCGCCG
CGCCGCGCCATGCTGGCCAAGTGGGTGTCGCAAAACTCGTCCACCTTTGGCGAGGCGACGCCGCCCGACGACATG
CACGCCCCCGTCTTCAACGCCTTCACCGTGTCCACCACGGACCCTGCACGCAGCGACCGCCCGGGCACCAGCAAG
TCGAGCCGCACCAGCCCGCAGTCGTCGGTGTCGCCCGCGTCGACCCAGTTCCCGCCCATGCCCAACACGCCGCTG
TCGCGCAGCGACTCGGGCTTTGCGCTGACGGCAACGCTGCGCGAGAAGCGGTCGGGGCACTTTGGCGAGGACAAG
GGCCGCCGCAGCTCGTCGTTTGGCCTGGACCGCATGCACCACCAGCAGCAGCCCCCTCCCCGCCCCGCCGGCGCA
TTGCTCAACGGCCACCAGGCCAATGCCTCCATCTCGGGCTTTTCCGTCGACTCGCACCAGGCCCTCAGCGTCGGC
TACGCGCCCTCGACGTATGCCCAGTCGACCCTGGCCGCCTCCACCATTATGCCCAGCATGCAGATCCAGCCCGTC
CACAACACCGACACCACCATGTGGGTCGAGGGCCACTGCCTGACGCTCAAGCCCAACGACGCCACGTCGACGTGC
ACCGTTTGCGACGACAAGCCCGACGGCGACGCCATGTACCAGTGCGCCGCCTGCACCATCATGGCCCACGCCCGC
TGCCTGGGCCAGGTGTCGCTCGTCTGTCCCGCCGCCTTTGACGCCGACCGCGTGCGCGCCGCCTTTGTGCGCTGC
ATGGCGAGCCTGCTGTATACCTACCGCAAGCACCTGGCGCGCCCGTCCAAGCAGCAGCGGAGCAACGGCCAGCTG
TATGCCTTTGACATGGAGGCCTTTATCAAGAGCCTGCCCCATGAGCAGCAAGACTATGCCCGCATGCTGCGCGAC
ACCCAGGCCTTCAACGAGTTTATCCACCAGCGCGAGACGACGCCTCCCACCGACCCCTCGATCCGCCTCTTTGAC
GAAATCATTGCCGCCAAGAGGGCCCGCGGCCGCCCTGGCCTCTCGTCGGGCCTGTCGCGTCTGTCCACCATTCGC
GCCTCTCACGGCGCCTCCACCAATGCCTGGCACATGCCTCCCCCCGCCCGGCCCCTCGCCACCAAGGCAACGAGC
TTCTTGTCCGACACGTCGGAGCACATTTGGCGCACCGCGTCGGTGCCGCCCGCAAAGGCACACTTCCCCGGCGAG
TACCGCTCCGTCGTGACGCGCATCCCCTCGCGCCTCGACCGCTCTCTGATGCGCGAGCCGCGCTCCATCCACGGC
GTCCCGCGGCCCGAGCAGCGCGGCCTGCGCGTCGTGCCTCGCAAGCAGGTGCCCAGCATGCTGGGCTCTACCCCT
CCGCCCTAG
Gene >OphauG2|4035
ATGGACAACTCGGCGTCGCCTCTGGCCGATTACTTCTGGATCGCCGGCGTAGAAGCCATTTCATACGACGATGAC
GTGCTGCCCGTAAGCCTGCCCGTCGACTCGACCATTAACGAAGACGGCGAGCCGGATGACAGCCGCATGCACTCG
GGCCAACCAAAGCTGAATGCTGCACGCCACTCGCGCCAAAACTCGGCAAACCGCCTCTCCAAGACGTCGTGCGAT
GGCCGCTTCTCCATGGCCACCTTTGACGACCGCGAAGGCACCACCAAGAGCAACCGCAGCAGCGCCACCATCAAG
CCTTCCAAGACGTCGGACAGCAACGGCAGCCTCAATGGCAGCTCCAACGGCCACGCCAATGGCAATGCCTCTGCC
GCTAATGCACCCGCCACACCCACAGACGCGCCGCCCCCGGGCCACTTTGACTTTGACACCGCCTTGGTCAAGTTT
GCTGCAGAGCGCGAAACCTTTCTCCAAGACCTCTCCTTTACAGCCGGCGCCAAGACGCAGTCCCGCCCGCCCATG
GTGAACCCCAGGGCCGAGCGCATCCGCGCCGACGACACGCCTCCCAGCGGGCGAATGAGCCCTCTCAAGAGCATC
AAGGGCAGCATCCGCCGCAAAATCAGCTTTAGAGACATGAACAGCATGCGCAAGCAGCCCGCGTCGGCCCGCCAG
AGTGTCGCTAGCAGAGCAGGTCTGTCCACAGCTTCTAGTGTGCAACAGCTTGCATGGGACCACTGTATTGACATT
CAGGGTCCACCAGCCTCTATCCGCACCGCAAAGCGACTCAGCAACTACAACTCTGTCATCCCACCCCCCGAGCCC
CTCAACATGGATCCCGACATGCATCCTCTCAAGCGGAGATTTGAGCCCGTCTTGCTCGACCGATACCCCCCCAAG
ACTGCCACGGACGAGATTGCCCGGCGCGGCAAGTTTCCCGACTATGTGCCCATGTTTGCCTTTCCCAACGACATT
CAGATTGTCTCGTCGGACGACCGGCCACGCTCCACATGGCACGGCTTTACCATGACTGCCGAAGACAACTCCAAG
CTCTACGGCATCACCATTATTGTGTGGGTAGCCCTGACGGCCGACGTGGCGGACGATGTGGAAACAAAGTGCGAG
CAGTGGCGGCAAAACCACATGTCGAATGAAGAGCGCGAGTTGGCTGCCAGTCTGGGCGTGCGCCTGGCGGGCGAA
CGCATACACTTGTCACAGCTGCTGTCGAGGCTGCCGGCCATGGCGTCTGGGTCGGTGGCTCGCGACGAGCTCGAA
GACGAGATTGGTCTGGTGGAGGAAAAGATTACGCTCATGACTGACATGCTCCGGCCGCTGCGGCACGGCGCGGCG
TCCAAGATTGAAGGGCTGACGGCTGGCGAGAGCGGGCTGTGGATTCCCCGGGCCTATGGCATCCTTGGACGGGAC
CCGGCCAACATGGCCTTTTGGAAGGAGTGGCTCAAGGCCATTGTGGTGCCCATGACGGACGGCAGCGTGCTGCGG
GTGCCGCCCAGCTCGCCGGTCAAGGGGCTGTGGCAGCCTCTGGAGCGCTACGTGGTCAACCTGTGCACCGAGGCG
GTCAGTCCGCTGGGGTCCAAGACGCAGGTGGAGCTGGTGGTGAGAGAGCTGAGGCTGTATGCGCGCAAGGAGGGC
CCCAATGAGCTGCCGGGCTCGCGGACGGTGGATGTGTATGCGCTGCTGCGCAGCCTCTCGCTGGAGAACGTGGTG
GCGCTGTTTGAGTACGCCATGTCTGAGTCCCGCATCATTTTCTTGTCGTCGCACACGAGCATGCTGCATCTGGCC
TGCCACGGCCTGGCCAGCCTGCTGTATCCCCTCAAGTGGGCCAGCATCTTCATCCCGGTGCTGCCGGCGCGGCTC
ATCTCGGCCCTCGAGGCGCCCTGCCCCTACATCATTGGCGTGGAGCGGCGATATGAGCGCATCGAGCTGCCCGAC
GACGACTACATCTTGGTGGACCTGGACAAGGACACGATTGACGCCACGTCGCAGCCGCACCGCCTCCCGCGACAG
CACCGCCGCAAGCTCATGTCGCTGCTCCAGATTGCCGCGCCGCACACGCTGCGCCTGGGCGTGGCGGTTGGGCCG
CCGCCGTACGCCATTGAGTCGTTTCCCTACGACTCCTTTTCGTCGGAGAACGGGTCCATCTTCACCGCGTCGCCG
CGCCGCGCCATGCTGGCCAAGTGGGTGTCGCAAAACTCGTCCACCTTTGGCGAGGCGACGCCGCCCGACGACATG
CACGCCCCCGTCTTCAACGCCTTCACCGTGTCCACCACGGACCCTGCACGCAGCGACCGCCCGGGCACCAGCAAG
TCGAGCCGCACCAGCCCGCAGTCGTCGGTGTCGCCCGCGTCGACCCAGTTCCCGCCCATGCCCAACACGCCGCTG
TCGCGCAGCGACTCGGGCTTTGCGCTGACGGCAACGCTGCGCGAGAAGCGGTCGGGGCACTTTGGCGAGGACAAG
GGCCGCCGCAGCTCGTCGTTTGGCCTGGACCGCATGCACCACCAGCAGCAGCCCCCTCCCCGCCCCGCCGGCGCA
TTGCTCAACGGCCACCAGGCCAATGCCTCCATCTCGGGCTTTTCCGTCGACTCGCACCAGGCCCTCAGCGTCGGC
TACGCGCCCTCGACGTATGCCCAGTCGACCCTGGCCGCCTCCACCATTATGCCCAGCATGCAGATCCAGCCCGTC
CACAACACCGACACCACCATGTGGGTCGAGGGCCACTGCCTGACGCTCAAGCCCAACGACGCCACGTCGACGTGC
ACCGTTTGCGACGACAAGCCCGACGGCGACGCCATGTACCAGTGCGCCGCCTGCACCATCATGGCCCACGCCCGC
TGCCTGGGCCAGGTGTCGCTCGTCTGTCCCGCCGCCTTTGACGCCGACCGCGTGCGCGCCGCCTTTGTGCGCTGC
ATGGCGAGCCTGCTGTATACCTACCGCAAGCACCTGGCGCGCCCGTCCAAGCAGCAGCGGAGCAACGGCCAGCTG
TATGCCTTTGACATGGAGGCCTTTATCAAGAGCCTGCCCCATGAGCAGCAAGACTATGCCCGCATGCTGCGCGAC
ACCCAGGGTTGGTTTTCTGCTGCCTACCCTTTTGCCCCTCTTTCTTCTCCTTTTGCTAACACCCCCAAGCCTTCA
ACGAGTTTATCCACCAGCGCGAGACGACGCCTCCCACCGACCCCTCGATCCGCCTCTTTGACGAAATCATTGCCG
CCAAGAGGGCCCGCGGCCGCCCTGGCCTCTCGTCGGGCCTGTCGCGTCTGTCCACCATTCGCGCCTCTCACGGCG
CCTCCACCAATGCCTGGCACATGCCTCCCCCCGCCCGGCCCCTCGCCACCAAGGCAACGAGCTTCTTGTCCGACA
CGTCGGAGCACATTTGGCGCACCGCGTCGGTGCCGCCCGCAAAGGCACACTTCCCCGGCGAGTACCGCTCCGTCG
TGACGCGCATCCCCTCGCGCCTCGACCGCTCTCTGATGCGCGAGCCGCGCTCCATCCACGGCGTCCCGCGGCCCG
AGCAGCGCGGCCTGCGCGTCGTGCCTCGCAAGCAGGTGCCCAGCATGCTGGGCTCTACCCCTCCGCCCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail