Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|4013
Gene name
LocationContig_32:4214..7063
Strand+
Gene length (bp)2849
Transcript length (bp)2562
Coding sequence length (bp)2562
Protein length (aa) 854

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12722 Hid1 High-temperature-induced dauer-formation protein 7.3E-281 1 791
PF09742 Dymeclin Dyggve-Melchior-Clausen syndrome protein 4.6E-84 1 746

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O13776|FT105_SCHPO Ubp5-interacting protein ftp105 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ftp105 PE=1 SV=2 1 808 5.0E-108
sp|Q8IV36|HID1_HUMAN Protein HID1 OS=Homo sapiens GN=HID1 PE=1 SV=1 1 811 1.0E-89
sp|Q9P7M6|YIOC_SCHPO Hid-1 family protein P27G11.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAP27G11.12 PE=3 SV=1 1 808 2.0E-87
sp|Q8R1F6|HID1_MOUSE Protein HID1 OS=Mus musculus GN=Hid1 PE=1 SV=1 1 811 2.0E-86
sp|Q54JJ6|HID1_DICDI Protein HID1 OS=Dictyostelium discoideum GN=hid1 PE=3 SV=1 160 812 2.0E-47
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O13776|FT105_SCHPO Ubp5-interacting protein ftp105 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ftp105 PE=1 SV=2 1 808 5.0E-108
sp|Q8IV36|HID1_HUMAN Protein HID1 OS=Homo sapiens GN=HID1 PE=1 SV=1 1 811 1.0E-89
sp|Q9P7M6|YIOC_SCHPO Hid-1 family protein P27G11.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAP27G11.12 PE=3 SV=1 1 808 2.0E-87
sp|Q8R1F6|HID1_MOUSE Protein HID1 OS=Mus musculus GN=Hid1 PE=1 SV=1 1 811 2.0E-86
sp|Q54JJ6|HID1_DICDI Protein HID1 OS=Dictyostelium discoideum GN=hid1 PE=3 SV=1 160 812 2.0E-47
sp|Q9HDV3|YOE7_SCHPO Hid-1 family protein P19A11.07c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1346.03 PE=3 SV=3 1 567 1.0E-15
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3416
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4013 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|1379
Ophiocordyceps camponoti-floridani Ophcf2|05843
Ophiocordyceps camponoti-rufipedis Ophun1|652
Ophiocordyceps kimflemingae Ophio5|4175
Ophiocordyceps subramaniannii Hirsu2|6435

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|4013
MGASDSKIVFKQGIFKLSEERNIPADDPYWTSFWELPESSEDVFSLFSPADIRRTRDQALENVETLILALTSRLF
ILRHHPSFPDPELAPEKDALNCVRILTRILPYLYETEALASWQERFFWGTRRKKTRKAAIAREVLFDEAESDKQD
VQPESQEFEDASPLAGELIDTLIDFLFYSDLTIPRQPAGHSKVTYAIWQSGVGCNAAVATTKEYESNRSEILRLL
LALAGQSMYMAPGVLPQAGVRTLTYICTNQEKQVVLSVLCSLLNTTLKYNPASWRVPYNALLSKDTKQILVTYSL
QFMLALLIYPIPEHASIQKNYYRHFLGRLHRPQDFQFVVDGMSRILSQPLQEKSSYLPGSQTSGNFAPEMLMLFW
EMTQCNKRFRSFIIDTDRAHDFVVLTLFYALEFKNEPSKQGIVRMCAFLLQTLSVEANFGQSLNKRFEGQDSLPA
CIRINGFKGSYADFLIHSIYSLITTSQGSFAVVYPALLAVIHNISPHVEELSATSSSQLLHLFSSMSSPSFLLAN
ETNHSLLLSLLESVNYVIEHKHRRNPELLLAIVKNRKRVEALRNFTLESGQEELERVNRKRKDMAAQGNPLEASS
LRSSADSARSPRSTASRSQALDGVPEDGTFAVGNDDDDENDATSDDNTQTTPAPSTASENQSQTSSAVNFDDAVP
VQLRGMSEKARGKMPAAVRSFSRQNSTTSLGAQSTTGQTSVTAFEPTPQWIDSWLPELPLHTMLAIIQQLSSLYP
HQTLTKDGSARSDLIRRIREIELVGVEPSAPRIQSFECEMQIAKGTMGVWSGTAIKLFRVQETAPEGPTLTGYCA
LKEWMATRAWFFTRFGGVEGKQPPFTVE*
Coding >OphauG2|4013
ATGGGCGCAAGCGACTCAAAAATTGTCTTTAAGCAGGGCATCTTCAAATTGTCTGAGGAGCGCAACATCCCCGCA
GACGACCCTTACTGGACATCGTTTTGGGAGTTGCCAGAGTCTTCGGAAGATGTCTTCAGCCTCTTCTCTCCCGCC
GACATTCGCCGAACCCGCGACCAGGCTTTGGAGAACGTCGAGACACTAATTCTGGCCCTGACCTCACGTCTCTTC
ATCCTCCGCCATCACCCGTCCTTTCCGGATCCCGAACTTGCCCCGGAGAAGGATGCTTTGAATTGTGTTCGAATT
CTAACTCGCATACTGCCCTATCTTTACGAAACGGAGGCTCTGGCATCTTGGCAAGAGCGCTTCTTCTGGGGCACT
CGCCGAAAGAAAACTCGCAAAGCTGCCATCGCCCGCGAGGTACTCTTTGACGAGGCTGAAAGCGACAAGCAGGAT
GTGCAACCCGAGTCGCAAGAGTTCGAGGACGCCAGTCCCCTGGCTGGAGAGCTCATAGACACGTTGATCGACTTT
CTCTTTTACTCGGACCTGACGATTCCTCGCCAACCCGCGGGCCATTCCAAGGTGACGTACGCAATCTGGCAGAGC
GGGGTTGGCTGCAATGCTGCTGTTGCTACTACCAAAGAATATGAGAGCAACAGATCTGAGATCTTGCGTCTGTTG
CTGGCTTTGGCTGGCCAGAGCATGTACATGGCGCCCGGTGTTCTCCCTCAAGCTGGCGTCCGTACTTTGACCTAT
ATCTGCACTAATCAGGAGAAGCAAGTTGTGCTTTCCGTCCTGTGTTCCCTGCTAAATACGACACTCAAGTATAAT
CCGGCAAGCTGGCGGGTACCCTACAATGCTCTCTTGTCCAAAGACACGAAACAAATCCTCGTCACGTACTCTTTG
CAATTCATGCTCGCCTTGCTCATATATCCTATCCCAGAACATGCGTCGATACAGAAGAATTATTATCGTCATTTT
CTCGGGCGCCTTCATCGCCCTCAGGACTTCCAATTCGTCGTCGACGGCATGAGTCGCATCCTGAGCCAGCCTCTG
CAGGAAAAGTCTTCCTATCTCCCCGGCTCTCAAACATCAGGCAACTTTGCACCCGAGATGCTGATGCTCTTTTGG
GAAATGACGCAATGCAACAAGAGATTCCGCTCCTTCATCATTGACACTGACAGAGCTCATGATTTCGTCGTTCTG
ACTTTATTCTACGCCCTCGAGTTCAAGAACGAACCATCAAAGCAGGGTATCGTTCGCATGTGCGCTTTTCTCTTG
CAAACGCTAAGTGTCGAAGCCAACTTTGGCCAAAGCCTCAATAAACGGTTCGAGGGCCAGGATAGCCTTCCGGCT
TGTATCAGAATCAACGGCTTCAAGGGATCATATGCCGATTTCCTCATTCATTCCATTTACAGCTTGATCACGACT
AGCCAGGGCAGCTTTGCTGTAGTCTATCCAGCACTCCTGGCAGTGATTCACAACATTTCTCCTCACGTGGAAGAG
CTTAGTGCGACAAGCAGCTCTCAGCTCCTGCATCTGTTCTCATCAATGTCTTCGCCGTCTTTTCTTCTTGCAAAT
GAGACGAACCATTCCCTTTTGCTTTCGCTGCTGGAGTCAGTCAACTACGTCATTGAGCACAAGCACCGCAGAAAC
CCTGAGCTTCTGCTGGCAATCGTTAAGAATAGGAAGCGTGTTGAGGCGCTAAGAAATTTCACGCTCGAGAGCGGT
CAGGAAGAACTAGAGAGGGTCAATCGAAAACGAAAGGACATGGCAGCTCAAGGAAACCCACTTGAGGCCAGCTCG
CTACGAAGTTCAGCTGACAGTGCGAGAAGCCCGCGATCGACAGCGTCTCGAAGCCAAGCGCTTGACGGAGTCCCT
GAGGATGGCACTTTTGCCGTTGGCAATGATGATGATGACGAAAACGACGCAACTAGTGACGATAACACGCAAACT
ACTCCAGCTCCCTCGACAGCAAGTGAAAATCAGTCTCAAACATCGTCTGCCGTCAACTTTGACGATGCTGTCCCT
GTTCAACTTCGCGGTATGTCTGAAAAGGCCCGCGGCAAGATGCCTGCAGCTGTCAGGTCGTTTTCGCGGCAAAAT
AGCACTACGAGCTTGGGCGCGCAGTCTACAACAGGACAGACATCTGTGACTGCATTCGAGCCAACGCCTCAGTGG
ATTGATAGCTGGTTGCCGGAATTGCCACTTCACACAATGTTGGCGATTATTCAGCAGCTTTCAAGCCTCTATCCC
CACCAGACTCTGACGAAAGACGGCTCAGCACGGTCAGATCTGATTCGTCGTATTAGAGAGATTGAGCTTGTTGGA
GTAGAGCCTTCAGCACCGCGCATACAGTCGTTTGAATGCGAAATGCAGATTGCCAAGGGTACCATGGGAGTCTGG
AGCGGCACGGCCATCAAGCTCTTCCGCGTTCAGGAGACGGCACCAGAAGGCCCCACGCTTACAGGCTACTGTGCC
TTGAAGGAATGGATGGCAACCAGGGCATGGTTCTTTACGAGGTTCGGCGGCGTGGAAGGAAAGCAGCCCCCGTTT
ACCGTGGAATGA
Transcript >OphauG2|4013
ATGGGCGCAAGCGACTCAAAAATTGTCTTTAAGCAGGGCATCTTCAAATTGTCTGAGGAGCGCAACATCCCCGCA
GACGACCCTTACTGGACATCGTTTTGGGAGTTGCCAGAGTCTTCGGAAGATGTCTTCAGCCTCTTCTCTCCCGCC
GACATTCGCCGAACCCGCGACCAGGCTTTGGAGAACGTCGAGACACTAATTCTGGCCCTGACCTCACGTCTCTTC
ATCCTCCGCCATCACCCGTCCTTTCCGGATCCCGAACTTGCCCCGGAGAAGGATGCTTTGAATTGTGTTCGAATT
CTAACTCGCATACTGCCCTATCTTTACGAAACGGAGGCTCTGGCATCTTGGCAAGAGCGCTTCTTCTGGGGCACT
CGCCGAAAGAAAACTCGCAAAGCTGCCATCGCCCGCGAGGTACTCTTTGACGAGGCTGAAAGCGACAAGCAGGAT
GTGCAACCCGAGTCGCAAGAGTTCGAGGACGCCAGTCCCCTGGCTGGAGAGCTCATAGACACGTTGATCGACTTT
CTCTTTTACTCGGACCTGACGATTCCTCGCCAACCCGCGGGCCATTCCAAGGTGACGTACGCAATCTGGCAGAGC
GGGGTTGGCTGCAATGCTGCTGTTGCTACTACCAAAGAATATGAGAGCAACAGATCTGAGATCTTGCGTCTGTTG
CTGGCTTTGGCTGGCCAGAGCATGTACATGGCGCCCGGTGTTCTCCCTCAAGCTGGCGTCCGTACTTTGACCTAT
ATCTGCACTAATCAGGAGAAGCAAGTTGTGCTTTCCGTCCTGTGTTCCCTGCTAAATACGACACTCAAGTATAAT
CCGGCAAGCTGGCGGGTACCCTACAATGCTCTCTTGTCCAAAGACACGAAACAAATCCTCGTCACGTACTCTTTG
CAATTCATGCTCGCCTTGCTCATATATCCTATCCCAGAACATGCGTCGATACAGAAGAATTATTATCGTCATTTT
CTCGGGCGCCTTCATCGCCCTCAGGACTTCCAATTCGTCGTCGACGGCATGAGTCGCATCCTGAGCCAGCCTCTG
CAGGAAAAGTCTTCCTATCTCCCCGGCTCTCAAACATCAGGCAACTTTGCACCCGAGATGCTGATGCTCTTTTGG
GAAATGACGCAATGCAACAAGAGATTCCGCTCCTTCATCATTGACACTGACAGAGCTCATGATTTCGTCGTTCTG
ACTTTATTCTACGCCCTCGAGTTCAAGAACGAACCATCAAAGCAGGGTATCGTTCGCATGTGCGCTTTTCTCTTG
CAAACGCTAAGTGTCGAAGCCAACTTTGGCCAAAGCCTCAATAAACGGTTCGAGGGCCAGGATAGCCTTCCGGCT
TGTATCAGAATCAACGGCTTCAAGGGATCATATGCCGATTTCCTCATTCATTCCATTTACAGCTTGATCACGACT
AGCCAGGGCAGCTTTGCTGTAGTCTATCCAGCACTCCTGGCAGTGATTCACAACATTTCTCCTCACGTGGAAGAG
CTTAGTGCGACAAGCAGCTCTCAGCTCCTGCATCTGTTCTCATCAATGTCTTCGCCGTCTTTTCTTCTTGCAAAT
GAGACGAACCATTCCCTTTTGCTTTCGCTGCTGGAGTCAGTCAACTACGTCATTGAGCACAAGCACCGCAGAAAC
CCTGAGCTTCTGCTGGCAATCGTTAAGAATAGGAAGCGTGTTGAGGCGCTAAGAAATTTCACGCTCGAGAGCGGT
CAGGAAGAACTAGAGAGGGTCAATCGAAAACGAAAGGACATGGCAGCTCAAGGAAACCCACTTGAGGCCAGCTCG
CTACGAAGTTCAGCTGACAGTGCGAGAAGCCCGCGATCGACAGCGTCTCGAAGCCAAGCGCTTGACGGAGTCCCT
GAGGATGGCACTTTTGCCGTTGGCAATGATGATGATGACGAAAACGACGCAACTAGTGACGATAACACGCAAACT
ACTCCAGCTCCCTCGACAGCAAGTGAAAATCAGTCTCAAACATCGTCTGCCGTCAACTTTGACGATGCTGTCCCT
GTTCAACTTCGCGGTATGTCTGAAAAGGCCCGCGGCAAGATGCCTGCAGCTGTCAGGTCGTTTTCGCGGCAAAAT
AGCACTACGAGCTTGGGCGCGCAGTCTACAACAGGACAGACATCTGTGACTGCATTCGAGCCAACGCCTCAGTGG
ATTGATAGCTGGTTGCCGGAATTGCCACTTCACACAATGTTGGCGATTATTCAGCAGCTTTCAAGCCTCTATCCC
CACCAGACTCTGACGAAAGACGGCTCAGCACGGTCAGATCTGATTCGTCGTATTAGAGAGATTGAGCTTGTTGGA
GTAGAGCCTTCAGCACCGCGCATACAGTCGTTTGAATGCGAAATGCAGATTGCCAAGGGTACCATGGGAGTCTGG
AGCGGCACGGCCATCAAGCTCTTCCGCGTTCAGGAGACGGCACCAGAAGGCCCCACGCTTACAGGCTACTGTGCC
TTGAAGGAATGGATGGCAACCAGGGCATGGTTCTTTACGAGGTTCGGCGGCGTGGAAGGAAAGCAGCCCCCGTTT
ACCGTGGAATGA
Gene >OphauG2|4013
ATGGGCGCAAGCGACTCAAAAATTGTCTTTAAGCAGGGCATCTTCAAATTGTCTGAGGAGCGCAACATCCCCGCA
GACGACCCTTACTGGACATCGGTTGGTGCTTCTTGACATCAAACGCTGTTGACGGCGCTGATGAGGATGCCAGTT
TTGGGAGTTGCCAGAGTCTTCGGAAGATGTCTTCAGCCTCTTCTCTCCCGCCGACATTCGCCGAACCCGCGACCA
GGCTTTGGAGAACGTCGAGACACTAATTCTGGCCCTGACCTCACGTCTCTTCATCCTCCGCCATCACCCGTCCTT
TCCGGATCCCGAACTTGCCCCGGAGAAGGATGCTTTGAATTGTGTTCGAATTCTAACTCGCATACTGCCCTATCT
TTACGAAACGGAGGCTCTGGCATCTTGGCAAGAGCGCTTCTTCTGGGGCACTCGCCGAAAGAAAACTCGCAAAGC
TGCCATCGCCCGCGAGGTACTCTTTGACGAGGCTGAAAGCGACAAGCAGGATGTGCAACCCGAGTCGCAAGAGTT
CGAGGACGCCAGTCCCCTGGCTGGAGAGCTCATAGACACGTTGATCGACTTTCTCTTTTACTCGGACCTGACGAT
TCCTCGCCAACCCGCGGGCCATTCCAAGGTGACGTACGCAATCTGGCAGAGCGGGGTTGGCTGCAATGCTGCTGT
TGCTACTACCAAAGAATATGAGAGCAACAGATCTGAGATCTTGCGTCTGTTGCTGGCTTTGGCTGGCCAGAGCAT
GTACATGGCGCCCGGTGTTCTCCCTCAAGCTGGCGTCCGTACTTTGACCTATATCTGCACTAATCAGGAGAAGCA
AGTTGTGCTTTCCGTCCTGTGTTCCCTGCTAAATACGGTACGTTTGGAGCATGCTCTGTTTATCCGGCCTTCTGA
CCCAGTCGAACATGCAGACACTCAAGTATAATCCGGCAAGCTGGCGGGTACCCTACAATGCTCTCTTGTCCAAAG
ACACGAAACAAATCCTCGTCACGTACTCTTTGCAATTCATGCTCGCCTTGCTCATATATCCTATCCCAGAACATG
CGTCGATACAGAAGAATTATTATCGTCATTTTCTCGGGCGCCTTCATCGCCCTCAGGACTTCCAATTCGTCGTCG
ACGGCATGAGTCGCATCCTGAGCCAGCCTCTGCAGGAAAAGTCTTCCTATCTCCCCGGCTCTCAAACATCAGGCA
ACTTTGCACCCGAGATGCTGATGCTCTTTTGGGAAATGACGCAATGCAACAAGAGATTCCGCTCCTTCATCATTG
ACACTGACAGAGCTCATGATTTCGTCGTTCTGACTTTATTCTACGCCCTCGAGTTCAAGAACGAACCATCAAAGC
AGGGTATCGTTCGCATGTGCGCTTTTCTCTTGCAAACGCTAAGTGTCGAAGCCAACTTTGGCCAAAGCCTCAATA
AACGGTTCGAGGGCCAGGATAGCCTTCCGGCTTGTATCAGAATCAACGGCTTCAAGGGATCATATGCCGATTTCC
TCATTCATTCCATTTACAGCTTGATCACGACTAGCCAGGGCAGCTTTGCTGTAGTCTATCCAGCACTCCTGGCAG
TGATTCACAACATTTCTCCTCACGTGGAAGAGCTTAGTGCGACAAGCAGCTCTCAGCTCCTGCATCTGTTCTCAT
CAATGTCTTCGCCGTCTTTTCTTCTTGCAAATGAGACGAACCATTCCCTTTTGCTTTCGCTGCTGGAGTCAGTCA
ACTACGTCATTGAGCACAAGCACCGCAGAAACCCTGAGCTTCTGCTGGCAATCGTTAAGAATAGGAAGCGTGTTG
AGGCGCTAAGAAATTTCACGCTCGAGAGCGGTCAGGAAGAACTAGAGAGGGTCAATCGAAAACGAAAGGACATGG
CAGCTCAAGGAAACCCACTTGAGGCCAGCTCGCTACGAAGTTCAGCTGACAGTGCGAGAAGCCCGCGATCGACAG
CGTCTCGAAGCCAAGCGCTTGACGGAGTCCCTGAGGATGGCACTTTTGCCGTTGGCAATGATGATGATGACGAAA
ACGACGCAACTAGTGACGATAACACGCAAACTACTCCAGCTCCCTCGACAGCAAGTGAAAATCAGTCTCAAACAT
CGTCTGCCGTCAACTTTGACGATGCTGTCCCTGTTCAACTTCGCGGTATGTCTGAAAAGGCCCGCGGCAAGATGC
CTGCAGCTGTCAGGTCGTTTTCGCGGCAAAATAGCACTACGAGCTTGGGCGCGCAGTCTACAACAGGACAGACAT
CTGTGACTGCATTCGAGCCAACGCCTCAGTGGATTGATAGCTGGTTGCCGGAATTGCCACTTCACACAATGTTGG
CGATTATTCAGCAGCTTTCAAGCCTCTATCCCCACCAGACTCTGACGAAAGACGGCTCAGCACGGTCAGATCTGA
TTCGTCGTATTAGAGAGATTGAGCTTGTTGGAGTAGAGCCTTCAGCACCGCGCATACAGTCGTTTGAATGGTCCC
CCCTGGCATTGGCGTGGTATGAGTCTCTACTCTGGGGCGTTGTGTTTTCCAGCGAAATGCAGATTGCCAAGGGTA
CCATGGGAGTCTGGAGCGGCACGGCCATCAAGCTCTTCCGCGTTCAGGAGACGGCACCAGAAGGCCCCACGCTTA
CGTCTCCACGAGGAGCAGTGGATGCTGTTGGAAGTAACATTGTGTCGAGAATAGGGCAAATAAATCTGCGTGGAG
CAGGACAGGGAAACGGGAGGCCTTCCTCAAGAGCTGATTCTTGAAATAGAGGCTACTGTGCCTTGAAGGAATGGA
TGGCAACCAGGGCATGGTTCTTTACGAGGTTCGGCGGCGTGGAAGGAAAGCAGCCCCCGTTTACCGTGGAATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail