Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|4012
Gene name
LocationContig_32:1085..3851
Strand-
Gene length (bp)2766
Transcript length (bp)2766
Coding sequence length (bp)2766
Protein length (aa) 922

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08634 Pet127 Mitochondrial protein Pet127 5.3E-113 414 686

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O74832|PT127_SCHPO mRNA degradation protein pet127, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pet127 PE=3 SV=1 353 703 2.0E-80
sp|P32606|PT127_YEAST Putative mitochondrial translation system component PET127 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PET127 PE=1 SV=2 362 669 3.0E-60

GO

GO Term Description Terminal node
GO:0000959 mitochondrial RNA metabolic process Yes
GO:0005739 mitochondrion Yes
GO:0043170 macromolecule metabolic process No
GO:0043226 organelle No
GO:0044238 primary metabolic process No
GO:0043231 intracellular membrane-bounded organelle No
GO:0008150 biological_process No
GO:0008152 metabolic process No
GO:0043227 membrane-bounded organelle No
GO:0043229 intracellular organelle No
GO:0009987 cellular process No
GO:0046483 heterocycle metabolic process No
GO:0005575 cellular_component No
GO:1901360 organic cyclic compound metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0071704 organic substance metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:0110165 cellular anatomical entity No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0044237 cellular metabolic process No
GO:0016070 RNA metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 17 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|4012
MLRLNHLSSTFVRAQPSIIIWQKNRRLATTRLYRQESAAQQSPIEQPPTHQVEILNDSKQKQEAEQTSNQAENSS
QQPDRTKITLEEQNRTSATSKPQSNDGNKPQKHIPRENVIAQPKKGSKQEQNPNRRLPRPGALILNRRCTQNKIP
QAKGPRRVRRRVPNNPGAARDSPDKYASYHEQLWNRSSIDLGEYIDIVKNAKTEVDPVIKAWIQLLKKSESFGKR
GALIKETPVLKSTPDLNTTSNQDQERTLSTVGSSPDDTSTHLSNSPCSHSDQAPLEQDTLKVEITQDSSSSQDAP
LNKSSPEGTSSDHVSHQTVKTSRAKAKTAKNLESINNPSSIRIETIDPSKLEFTALEESDVEKVPFLQYDLDRVL
FQCGVQQMQDERTGVFNFDPYLATIMPTNEFDFDALKEYVTSSKDDKLRGLASNHGTKYCGSTSSMTAILSHFHY
LISAWRLPNFGHVSRSVSLENENFTIITRAPAAAYLAYKDGVYAIDADKQFDTENVLSMLGKSMEKLLTLPKDDY
EKYRRTKSHTLPQELREASETYHYSKMGDLLMRSQLDAKDPRLPGAGIFDLKTRAVVSIRMDVRGYKKGVGYEIR
KQFGEWQSFEREYFDMIRAAFLKYSLQVRMGRMDGIFVAFHNTQRIFGFQYYALKDMDWALHGTHDPRLGDQEFL
LSLKLLNHLMNIATQRFPGRTLRIHVETRPVRATTLNFFAEPISDEQMHKNQQSCKPLVEQLENEIRGLTPNKYE
TQGQPKNSEDKKSTKQPDSGGSVTDQESFERAMEAALQSAQAKEGKGGKMDEDDVSELLGLSVSLRNHVNGSFVR
RPVIEDEDSPFNWKIQYVVNELSDDEAQTLYKATKKRRRTVFTKTPDEASRAWQKMFKGQLRLMTEEGTRHRKRM
TQLYQNEAVRVAWNMDPLPKS*
Coding >OphauG2|4012
ATGTTACGACTTAATCATCTTTCGAGCACTTTCGTCCGCGCCCAACCTTCCATCATCATCTGGCAAAAAAACAGA
CGTCTTGCGACCACCCGGCTATATCGACAAGAGAGCGCGGCACAGCAAAGCCCAATCGAACAGCCACCTACACAC
CAGGTCGAGATTCTAAATGACTCGAAACAGAAGCAAGAAGCAGAACAAACGTCAAATCAAGCAGAGAATTCATCG
CAACAGCCAGACAGAACAAAAATCACATTAGAGGAACAGAACAGAACATCAGCCACTTCAAAGCCGCAGAGCAAC
GATGGAAATAAACCACAGAAACATATTCCTAGAGAAAATGTAATCGCACAGCCGAAGAAAGGCTCGAAGCAGGAG
CAGAATCCAAATAGAAGACTACCAAGGCCGGGGGCTTTGATATTAAATCGAAGGTGCACACAAAACAAAATTCCA
CAAGCCAAAGGGCCCCGGAGGGTACGCCGCAGGGTGCCCAACAATCCCGGAGCAGCGCGCGATTCGCCAGACAAA
TATGCCTCTTACCATGAACAATTATGGAACCGGAGCAGCATAGACCTGGGCGAGTACATTGACATCGTTAAAAAC
GCAAAAACTGAAGTCGATCCTGTCATAAAGGCTTGGATACAGCTGCTCAAAAAATCCGAATCATTTGGCAAACGT
GGCGCTCTGATAAAAGAGACTCCAGTTTTGAAGAGCACGCCAGACTTGAATACTACATCAAACCAGGATCAAGAG
AGGACTTTGTCCACTGTCGGTTCTTCACCCGATGATACTAGCACACATTTGTCCAATTCGCCATGCTCTCACTCC
GACCAAGCGCCCCTGGAACAAGATACCTTAAAGGTCGAAATTACACAAGACTCATCTTCTAGCCAGGATGCGCCT
TTGAACAAAAGCTCCCCCGAGGGTACCTCATCTGATCATGTTTCTCATCAGACTGTGAAAACAAGTCGAGCTAAA
GCCAAAACCGCCAAGAATCTCGAATCTATAAACAATCCATCATCAATTAGAATCGAGACAATCGATCCCTCGAAA
TTAGAATTTACTGCTCTTGAGGAATCTGATGTCGAGAAAGTGCCATTTCTTCAATACGATCTGGACCGTGTTCTG
TTCCAATGCGGCGTACAGCAAATGCAGGATGAACGCACTGGCGTCTTCAACTTCGATCCGTACTTGGCAACCATT
ATGCCCACTAATGAATTCGACTTTGACGCTCTCAAGGAATATGTTACGTCTTCCAAGGATGACAAGTTGCGGGGT
CTCGCATCTAACCACGGCACCAAGTATTGTGGCTCAACATCAAGCATGACGGCTATTCTCTCTCACTTTCACTAT
CTCATTTCCGCATGGAGGCTCCCCAATTTTGGACATGTGTCTCGCTCAGTCTCGCTTGAGAATGAGAATTTCACC
ATCATCACTCGTGCGCCCGCGGCTGCCTATCTAGCCTATAAAGATGGGGTTTATGCCATCGATGCGGATAAGCAA
TTTGACACGGAAAATGTTCTTAGCATGCTTGGCAAATCAATGGAAAAACTCTTGACGCTCCCAAAGGACGATTAT
GAGAAATATCGGCGGACAAAGTCACATACGCTACCCCAAGAGCTGCGAGAGGCATCAGAAACATACCATTACTCG
AAGATGGGCGACTTGCTGATGCGGTCACAACTTGATGCCAAAGACCCCCGTCTGCCGGGCGCCGGCATTTTCGAT
CTCAAAACCAGGGCGGTCGTGTCTATTCGGATGGATGTGCGAGGCTACAAGAAGGGCGTGGGCTATGAAATCCGC
AAACAGTTTGGCGAGTGGCAGTCGTTTGAGCGCGAGTATTTTGACATGATCCGAGCCGCTTTTCTCAAGTACTCA
TTGCAGGTCCGTATGGGACGCATGGACGGCATATTCGTTGCCTTTCACAACACGCAGCGTATTTTTGGCTTCCAA
TACTATGCTCTGAAGGACATGGACTGGGCCCTTCACGGCACACATGATCCACGGCTTGGCGACCAGGAGTTTTTG
TTGAGCCTCAAACTTTTGAACCATTTGATGAACATTGCAACACAGCGTTTTCCTGGCCGAACGCTGCGTATCCAT
GTGGAAACGCGGCCGGTTCGCGCAACCACGTTGAACTTCTTTGCCGAGCCAATCAGCGATGAACAGATGCATAAG
AACCAGCAATCTTGCAAACCACTTGTTGAGCAATTGGAGAATGAGATTCGTGGGCTGACTCCCAACAAATATGAG
ACGCAAGGACAACCCAAAAATAGTGAGGATAAGAAGTCGACCAAGCAGCCAGACAGCGGCGGTTCAGTGACGGAC
CAAGAGTCTTTTGAAAGGGCTATGGAAGCGGCTTTGCAGAGCGCTCAGGCAAAAGAGGGTAAAGGCGGGAAGATG
GATGAAGACGATGTGTCAGAGCTGTTGGGCCTTTCCGTCTCACTCCGAAACCATGTGAACGGTAGCTTTGTCCGC
CGGCCAGTCATTGAAGATGAGGATTCTCCGTTTAATTGGAAAATCCAGTACGTCGTGAACGAACTCTCAGACGAC
GAGGCTCAAACCTTGTACAAAGCAACCAAGAAGCGGAGACGAACTGTGTTCACCAAGACCCCTGATGAAGCATCA
AGAGCGTGGCAGAAGATGTTCAAGGGACAGCTGCGACTCATGACAGAGGAGGGGACGCGACACAGGAAGCGCATG
ACGCAGCTATACCAAAATGAGGCTGTTCGTGTGGCCTGGAATATGGATCCACTGCCCAAATCATGA
Transcript >OphauG2|4012
ATGTTACGACTTAATCATCTTTCGAGCACTTTCGTCCGCGCCCAACCTTCCATCATCATCTGGCAAAAAAACAGA
CGTCTTGCGACCACCCGGCTATATCGACAAGAGAGCGCGGCACAGCAAAGCCCAATCGAACAGCCACCTACACAC
CAGGTCGAGATTCTAAATGACTCGAAACAGAAGCAAGAAGCAGAACAAACGTCAAATCAAGCAGAGAATTCATCG
CAACAGCCAGACAGAACAAAAATCACATTAGAGGAACAGAACAGAACATCAGCCACTTCAAAGCCGCAGAGCAAC
GATGGAAATAAACCACAGAAACATATTCCTAGAGAAAATGTAATCGCACAGCCGAAGAAAGGCTCGAAGCAGGAG
CAGAATCCAAATAGAAGACTACCAAGGCCGGGGGCTTTGATATTAAATCGAAGGTGCACACAAAACAAAATTCCA
CAAGCCAAAGGGCCCCGGAGGGTACGCCGCAGGGTGCCCAACAATCCCGGAGCAGCGCGCGATTCGCCAGACAAA
TATGCCTCTTACCATGAACAATTATGGAACCGGAGCAGCATAGACCTGGGCGAGTACATTGACATCGTTAAAAAC
GCAAAAACTGAAGTCGATCCTGTCATAAAGGCTTGGATACAGCTGCTCAAAAAATCCGAATCATTTGGCAAACGT
GGCGCTCTGATAAAAGAGACTCCAGTTTTGAAGAGCACGCCAGACTTGAATACTACATCAAACCAGGATCAAGAG
AGGACTTTGTCCACTGTCGGTTCTTCACCCGATGATACTAGCACACATTTGTCCAATTCGCCATGCTCTCACTCC
GACCAAGCGCCCCTGGAACAAGATACCTTAAAGGTCGAAATTACACAAGACTCATCTTCTAGCCAGGATGCGCCT
TTGAACAAAAGCTCCCCCGAGGGTACCTCATCTGATCATGTTTCTCATCAGACTGTGAAAACAAGTCGAGCTAAA
GCCAAAACCGCCAAGAATCTCGAATCTATAAACAATCCATCATCAATTAGAATCGAGACAATCGATCCCTCGAAA
TTAGAATTTACTGCTCTTGAGGAATCTGATGTCGAGAAAGTGCCATTTCTTCAATACGATCTGGACCGTGTTCTG
TTCCAATGCGGCGTACAGCAAATGCAGGATGAACGCACTGGCGTCTTCAACTTCGATCCGTACTTGGCAACCATT
ATGCCCACTAATGAATTCGACTTTGACGCTCTCAAGGAATATGTTACGTCTTCCAAGGATGACAAGTTGCGGGGT
CTCGCATCTAACCACGGCACCAAGTATTGTGGCTCAACATCAAGCATGACGGCTATTCTCTCTCACTTTCACTAT
CTCATTTCCGCATGGAGGCTCCCCAATTTTGGACATGTGTCTCGCTCAGTCTCGCTTGAGAATGAGAATTTCACC
ATCATCACTCGTGCGCCCGCGGCTGCCTATCTAGCCTATAAAGATGGGGTTTATGCCATCGATGCGGATAAGCAA
TTTGACACGGAAAATGTTCTTAGCATGCTTGGCAAATCAATGGAAAAACTCTTGACGCTCCCAAAGGACGATTAT
GAGAAATATCGGCGGACAAAGTCACATACGCTACCCCAAGAGCTGCGAGAGGCATCAGAAACATACCATTACTCG
AAGATGGGCGACTTGCTGATGCGGTCACAACTTGATGCCAAAGACCCCCGTCTGCCGGGCGCCGGCATTTTCGAT
CTCAAAACCAGGGCGGTCGTGTCTATTCGGATGGATGTGCGAGGCTACAAGAAGGGCGTGGGCTATGAAATCCGC
AAACAGTTTGGCGAGTGGCAGTCGTTTGAGCGCGAGTATTTTGACATGATCCGAGCCGCTTTTCTCAAGTACTCA
TTGCAGGTCCGTATGGGACGCATGGACGGCATATTCGTTGCCTTTCACAACACGCAGCGTATTTTTGGCTTCCAA
TACTATGCTCTGAAGGACATGGACTGGGCCCTTCACGGCACACATGATCCACGGCTTGGCGACCAGGAGTTTTTG
TTGAGCCTCAAACTTTTGAACCATTTGATGAACATTGCAACACAGCGTTTTCCTGGCCGAACGCTGCGTATCCAT
GTGGAAACGCGGCCGGTTCGCGCAACCACGTTGAACTTCTTTGCCGAGCCAATCAGCGATGAACAGATGCATAAG
AACCAGCAATCTTGCAAACCACTTGTTGAGCAATTGGAGAATGAGATTCGTGGGCTGACTCCCAACAAATATGAG
ACGCAAGGACAACCCAAAAATAGTGAGGATAAGAAGTCGACCAAGCAGCCAGACAGCGGCGGTTCAGTGACGGAC
CAAGAGTCTTTTGAAAGGGCTATGGAAGCGGCTTTGCAGAGCGCTCAGGCAAAAGAGGGTAAAGGCGGGAAGATG
GATGAAGACGATGTGTCAGAGCTGTTGGGCCTTTCCGTCTCACTCCGAAACCATGTGAACGGTAGCTTTGTCCGC
CGGCCAGTCATTGAAGATGAGGATTCTCCGTTTAATTGGAAAATCCAGTACGTCGTGAACGAACTCTCAGACGAC
GAGGCTCAAACCTTGTACAAAGCAACCAAGAAGCGGAGACGAACTGTGTTCACCAAGACCCCTGATGAAGCATCA
AGAGCGTGGCAGAAGATGTTCAAGGGACAGCTGCGACTCATGACAGAGGAGGGGACGCGACACAGGAAGCGCATG
ACGCAGCTATACCAAAATGAGGCTGTTCGTGTGGCCTGGAATATGGATCCACTGCCCAAATCATGA
Gene >OphauG2|4012
ATGTTACGACTTAATCATCTTTCGAGCACTTTCGTCCGCGCCCAACCTTCCATCATCATCTGGCAAAAAAACAGA
CGTCTTGCGACCACCCGGCTATATCGACAAGAGAGCGCGGCACAGCAAAGCCCAATCGAACAGCCACCTACACAC
CAGGTCGAGATTCTAAATGACTCGAAACAGAAGCAAGAAGCAGAACAAACGTCAAATCAAGCAGAGAATTCATCG
CAACAGCCAGACAGAACAAAAATCACATTAGAGGAACAGAACAGAACATCAGCCACTTCAAAGCCGCAGAGCAAC
GATGGAAATAAACCACAGAAACATATTCCTAGAGAAAATGTAATCGCACAGCCGAAGAAAGGCTCGAAGCAGGAG
CAGAATCCAAATAGAAGACTACCAAGGCCGGGGGCTTTGATATTAAATCGAAGGTGCACACAAAACAAAATTCCA
CAAGCCAAAGGGCCCCGGAGGGTACGCCGCAGGGTGCCCAACAATCCCGGAGCAGCGCGCGATTCGCCAGACAAA
TATGCCTCTTACCATGAACAATTATGGAACCGGAGCAGCATAGACCTGGGCGAGTACATTGACATCGTTAAAAAC
GCAAAAACTGAAGTCGATCCTGTCATAAAGGCTTGGATACAGCTGCTCAAAAAATCCGAATCATTTGGCAAACGT
GGCGCTCTGATAAAAGAGACTCCAGTTTTGAAGAGCACGCCAGACTTGAATACTACATCAAACCAGGATCAAGAG
AGGACTTTGTCCACTGTCGGTTCTTCACCCGATGATACTAGCACACATTTGTCCAATTCGCCATGCTCTCACTCC
GACCAAGCGCCCCTGGAACAAGATACCTTAAAGGTCGAAATTACACAAGACTCATCTTCTAGCCAGGATGCGCCT
TTGAACAAAAGCTCCCCCGAGGGTACCTCATCTGATCATGTTTCTCATCAGACTGTGAAAACAAGTCGAGCTAAA
GCCAAAACCGCCAAGAATCTCGAATCTATAAACAATCCATCATCAATTAGAATCGAGACAATCGATCCCTCGAAA
TTAGAATTTACTGCTCTTGAGGAATCTGATGTCGAGAAAGTGCCATTTCTTCAATACGATCTGGACCGTGTTCTG
TTCCAATGCGGCGTACAGCAAATGCAGGATGAACGCACTGGCGTCTTCAACTTCGATCCGTACTTGGCAACCATT
ATGCCCACTAATGAATTCGACTTTGACGCTCTCAAGGAATATGTTACGTCTTCCAAGGATGACAAGTTGCGGGGT
CTCGCATCTAACCACGGCACCAAGTATTGTGGCTCAACATCAAGCATGACGGCTATTCTCTCTCACTTTCACTAT
CTCATTTCCGCATGGAGGCTCCCCAATTTTGGACATGTGTCTCGCTCAGTCTCGCTTGAGAATGAGAATTTCACC
ATCATCACTCGTGCGCCCGCGGCTGCCTATCTAGCCTATAAAGATGGGGTTTATGCCATCGATGCGGATAAGCAA
TTTGACACGGAAAATGTTCTTAGCATGCTTGGCAAATCAATGGAAAAACTCTTGACGCTCCCAAAGGACGATTAT
GAGAAATATCGGCGGACAAAGTCACATACGCTACCCCAAGAGCTGCGAGAGGCATCAGAAACATACCATTACTCG
AAGATGGGCGACTTGCTGATGCGGTCACAACTTGATGCCAAAGACCCCCGTCTGCCGGGCGCCGGCATTTTCGAT
CTCAAAACCAGGGCGGTCGTGTCTATTCGGATGGATGTGCGAGGCTACAAGAAGGGCGTGGGCTATGAAATCCGC
AAACAGTTTGGCGAGTGGCAGTCGTTTGAGCGCGAGTATTTTGACATGATCCGAGCCGCTTTTCTCAAGTACTCA
TTGCAGGTCCGTATGGGACGCATGGACGGCATATTCGTTGCCTTTCACAACACGCAGCGTATTTTTGGCTTCCAA
TACTATGCTCTGAAGGACATGGACTGGGCCCTTCACGGCACACATGATCCACGGCTTGGCGACCAGGAGTTTTTG
TTGAGCCTCAAACTTTTGAACCATTTGATGAACATTGCAACACAGCGTTTTCCTGGCCGAACGCTGCGTATCCAT
GTGGAAACGCGGCCGGTTCGCGCAACCACGTTGAACTTCTTTGCCGAGCCAATCAGCGATGAACAGATGCATAAG
AACCAGCAATCTTGCAAACCACTTGTTGAGCAATTGGAGAATGAGATTCGTGGGCTGACTCCCAACAAATATGAG
ACGCAAGGACAACCCAAAAATAGTGAGGATAAGAAGTCGACCAAGCAGCCAGACAGCGGCGGTTCAGTGACGGAC
CAAGAGTCTTTTGAAAGGGCTATGGAAGCGGCTTTGCAGAGCGCTCAGGCAAAAGAGGGTAAAGGCGGGAAGATG
GATGAAGACGATGTGTCAGAGCTGTTGGGCCTTTCCGTCTCACTCCGAAACCATGTGAACGGTAGCTTTGTCCGC
CGGCCAGTCATTGAAGATGAGGATTCTCCGTTTAATTGGAAAATCCAGTACGTCGTGAACGAACTCTCAGACGAC
GAGGCTCAAACCTTGTACAAAGCAACCAAGAAGCGGAGACGAACTGTGTTCACCAAGACCCCTGATGAAGCATCA
AGAGCGTGGCAGAAGATGTTCAAGGGACAGCTGCGACTCATGACAGAGGAGGGGACGCGACACAGGAAGCGCATG
ACGCAGCTATACCAAAATGAGGCTGTTCGTGTGGCCTGGAATATGGATCCACTGCCCAAATCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail