Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|4000
Gene name
LocationContig_318:12278..13795
Strand-
Gene length (bp)1517
Transcript length (bp)1407
Coding sequence length (bp)1407
Protein length (aa) 469

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01494 FAD_binding_3 FAD binding domain 3.8E-12 166 379

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O81360|ABA2_PRUAR Zeaxanthin epoxidase, chloroplastic OS=Prunus armeniaca PE=2 SV=1 169 400 6.0E-09
sp|Q40412|ABA2_NICPL Zeaxanthin epoxidase, chloroplastic OS=Nicotiana plumbaginifolia GN=ABA2 PE=1 SV=1 124 400 1.0E-07
sp|Q0JCU7|ZEP_ORYSJ Zeaxanthin epoxidase, chloroplastic OS=Oryza sativa subsp. japonica GN=ZEP PE=2 SV=1 140 400 7.0E-07
sp|Q9FGC7|ZEP_ARATH Zeaxanthin epoxidase, chloroplastic OS=Arabidopsis thaliana GN=ZEP PE=1 SV=1 2 400 7.0E-07
sp|Q9S3U9|VIOC_CHRVO Probable monooxygenase VioC OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=vioC PE=1 SV=2 163 423 2.0E-06

GO

GO Term Description Terminal node
GO:0071949 FAD binding Yes
GO:0003674 molecular_function No
GO:1901363 heterocyclic compound binding No
GO:0036094 small molecule binding No
GO:0043168 anion binding No
GO:0005488 binding No
GO:0050660 flavin adenine dinucleotide binding No
GO:0043167 ion binding No
GO:0097159 organic cyclic compound binding No
GO:0000166 nucleotide binding No
GO:1901265 nucleoside phosphate binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4536
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4000 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|7464
Ophiocordyceps camponoti-floridani Ophcf2|06248
Ophiocordyceps camponoti-rufipedis Ophun1|5935
Ophiocordyceps kimflemingae Ophio5|3266
Ophiocordyceps subramaniannii Hirsu2|9479

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|4000
MKIAIVGAGISGCATYLLLKKHLPPPLGDEPHSITIYEAHDTATSQEDRDQDSSTPTVGGGLGVGANGLGVLKRL
EEKLLCEVVASGYVVPTIVFKTKHATVLVRAQHQCNNGSDAQMHTVASSRHRLWSCLRSRIPESDIVVKQVTHVV
ADPMRRNTISFADGSPSVEADMVIGADGVKSPTRRALFPDSEHDDFSPHFEGLIGVGGFIPSANAQKHVEKGTMN
FVFGGNGFFGYFFADSAAGAPQRASPFHVSEPGDRLAWWSTFAADKYRGPGMLDKQAVARQLRNRLRHWKDPVVQ
EVLASLHVDSIYPTWTVPLLPTWERDGVVLVGDAAHALPPTSGQGTSQALEDAEALTLLLCYYLGEAYRERLAHV
QGQKQAIRMAAKRYENLRLPRVTKILRDAQSRQNTKRNKGFIAEKLMYLMLWIIGWFPSLVMKQMSTVVDYNVAH
EVKKLVEKEKETAKEKED*
Coding >OphauG2|4000
ATGAAGATTGCTATTGTTGGCGCCGGCATCTCGGGCTGTGCCACGTACCTGCTGCTCAAAAAGCATCTGCCCCCG
CCTCTCGGTGACGAGCCACACTCCATCACCATCTATGAGGCGCACGACACGGCCACGTCACAAGAGGACAGGGAC
CAAGATTCGTCGACGCCTACTGTAGGCGGTGGTCTCGGGGTCGGTGCAAATGGGCTCGGTGTGCTCAAGCGTCTG
GAGGAGAAGCTGCTCTGCGAAGTTGTTGCTAGTGGATATGTGGTGCCAACCATTGTATTCAAGACCAAGCACGCG
ACCGTCTTGGTTCGCGCTCAACACCAATGCAACAACGGCAGTGACGCTCAGATGCACACGGTTGCCAGCAGCCGC
CACAGGCTCTGGAGCTGTCTTCGTTCCCGCATTCCTGAAAGCGACATTGTTGTCAAACAGGTCACTCATGTAGTT
GCAGACCCGATGCGCCGCAACACAATCAGCTTTGCCGACGGCAGTCCCTCGGTTGAGGCAGACATGGTTATAGGT
GCCGATGGCGTCAAAAGCCCGACTCGACGTGCCCTCTTTCCCGACAGCGAGCACGACGACTTTTCGCCTCACTTC
GAGGGTCTTATTGGAGTCGGTGGGTTTATTCCCTCTGCCAATGCGCAAAAGCACGTGGAGAAGGGCACCATGAAT
TTTGTCTTTGGCGGCAACGGCTTCTTTGGCTACTTCTTTGCCGATAGCGCCGCAGGGGCACCCCAACGCGCATCG
CCCTTTCATGTGTCGGAGCCGGGAGACCGACTGGCCTGGTGGTCGACTTTTGCGGCCGACAAGTATCGGGGCCCA
GGTATGCTTGACAAGCAAGCCGTTGCACGCCAGCTGCGGAACCGCTTGCGTCACTGGAAAGACCCCGTGGTCCAA
GAGGTTCTGGCCTCGCTTCATGTGGATAGCATCTATCCTACCTGGACTGTTCCCTTACTGCCCACCTGGGAGCGT
GATGGAGTCGTTCTGGTTGGTGACGCGGCTCACGCGCTGCCGCCCACATCAGGTCAAGGAACGTCGCAGGCCCTT
GAAGATGCCGAGGCCTTAACTCTGCTTCTCTGCTACTACCTAGGCGAGGCATACCGCGAGCGATTGGCACATGTC
CAAGGGCAGAAGCAAGCAATCAGAATGGCGGCCAAGAGGTATGAAAATCTGCGGTTACCCCGAGTAACCAAGATA
CTGCGAGATGCACAAAGCAGGCAGAACACCAAGCGCAACAAGGGATTCATCGCCGAGAAGCTCATGTACTTGATG
CTGTGGATAATTGGATGGTTTCCGAGCCTCGTGATGAAACAAATGAGTACAGTCGTTGATTACAATGTAGCCCAC
GAGGTTAAGAAACTTGTTGAAAAGGAAAAGGAAACGGCAAAGGAAAAAGAGGATTGA
Transcript >OphauG2|4000
ATGAAGATTGCTATTGTTGGCGCCGGCATCTCGGGCTGTGCCACGTACCTGCTGCTCAAAAAGCATCTGCCCCCG
CCTCTCGGTGACGAGCCACACTCCATCACCATCTATGAGGCGCACGACACGGCCACGTCACAAGAGGACAGGGAC
CAAGATTCGTCGACGCCTACTGTAGGCGGTGGTCTCGGGGTCGGTGCAAATGGGCTCGGTGTGCTCAAGCGTCTG
GAGGAGAAGCTGCTCTGCGAAGTTGTTGCTAGTGGATATGTGGTGCCAACCATTGTATTCAAGACCAAGCACGCG
ACCGTCTTGGTTCGCGCTCAACACCAATGCAACAACGGCAGTGACGCTCAGATGCACACGGTTGCCAGCAGCCGC
CACAGGCTCTGGAGCTGTCTTCGTTCCCGCATTCCTGAAAGCGACATTGTTGTCAAACAGGTCACTCATGTAGTT
GCAGACCCGATGCGCCGCAACACAATCAGCTTTGCCGACGGCAGTCCCTCGGTTGAGGCAGACATGGTTATAGGT
GCCGATGGCGTCAAAAGCCCGACTCGACGTGCCCTCTTTCCCGACAGCGAGCACGACGACTTTTCGCCTCACTTC
GAGGGTCTTATTGGAGTCGGTGGGTTTATTCCCTCTGCCAATGCGCAAAAGCACGTGGAGAAGGGCACCATGAAT
TTTGTCTTTGGCGGCAACGGCTTCTTTGGCTACTTCTTTGCCGATAGCGCCGCAGGGGCACCCCAACGCGCATCG
CCCTTTCATGTGTCGGAGCCGGGAGACCGACTGGCCTGGTGGTCGACTTTTGCGGCCGACAAGTATCGGGGCCCA
GGTATGCTTGACAAGCAAGCCGTTGCACGCCAGCTGCGGAACCGCTTGCGTCACTGGAAAGACCCCGTGGTCCAA
GAGGTTCTGGCCTCGCTTCATGTGGATAGCATCTATCCTACCTGGACTGTTCCCTTACTGCCCACCTGGGAGCGT
GATGGAGTCGTTCTGGTTGGTGACGCGGCTCACGCGCTGCCGCCCACATCAGGTCAAGGAACGTCGCAGGCCCTT
GAAGATGCCGAGGCCTTAACTCTGCTTCTCTGCTACTACCTAGGCGAGGCATACCGCGAGCGATTGGCACATGTC
CAAGGGCAGAAGCAAGCAATCAGAATGGCGGCCAAGAGGTATGAAAATCTGCGGTTACCCCGAGTAACCAAGATA
CTGCGAGATGCACAAAGCAGGCAGAACACCAAGCGCAACAAGGGATTCATCGCCGAGAAGCTCATGTACTTGATG
CTGTGGATAATTGGATGGTTTCCGAGCCTCGTGATGAAACAAATGAGTACAGTCGTTGATTACAATGTAGCCCAC
GAGGTTAAGAAACTTGTTGAAAAGGAAAAGGAAACGGCAAAGGAAAAAGAGGATTGA
Gene >OphauG2|4000
ATGAAGATTGCTATTGTTGGCGCCGGCATCTCGGGCTGTGCCACGTACCTGCTGCTCAAAAAGCATCTGCCCCCG
CCTCTCGGTGACGAGCCACACTCCATCACCATCTATGAGGCGCACGACACGGCCACGTCACAAGAGGACAGGGAC
CAAGATTCGTCGACGCCTACTGTAGGCGGTGGTCTCGGGGTCGGTGCAAATGGGCTCGGTGTGCTCAAGCGTCTG
GAGGAGAAGCTGCTCTGCGAAGTTGTTGCTAGTGGATATGTGGTGCCAACCATTGTATTCAAGACCAAGCACGCG
ACCGTCTTGGTTCGCGCTCAACACCAATGCAACAACGGCAGTGACGCTCAGATGCACACGGTTGCCAGCAGCCGC
CACAGGCTCTGGAGCTGTCTTCGTTCCCGCATTCCTGAAAGCGACATTGTTGTCAAACAGGTCACTCATGTAGTT
GCAGACCCGATGCGCCGCAACACAATCAGCTTTGCCGACGGCAGTCCCTCGGTTGAGGCAGACATGGTTATAGGT
GCCGATGGCGTCAAAAGCCCGACTCGACGTGCCCTCTTTCCCGACAGCGAGCACGACGACTTTTCGCCTCACTTC
GAGTAAGTGGCTTGCCCTTCTCGTCAAGGCGCCAACGGGCGCTGACGGGCAACAGGGGTCTTATTGGAGTCGGTG
GGTTTATTCCCTCTGCCAATGCGCAAAAGCACGTGGAGAAGGGCACCATGAATTTTGTCTTTGGCGGCAACGGCT
TCTTTGGCTACTTCTTTGCCGATAGCGCCGCAGGGGCACCCCAACGCGCATCGCCCTTTCATGTGTCGGAGCCGG
GAGACCGACTGGCCTGGTGGTCGACTTTTGCGGCCGACAAGTATCGGGGCCCAGGTATGCTTGACAAGCAAGCCG
TTGCACGCCAGCTGCGGAACCGCTTGCGTCACTGGAAAGACCCCGTGGTCCAAGAGGTTCTGGCCTCGCTTCATG
TGGATAGCATCTATCCTACCTGGACTGTTCCCTTACTGCCCACCTGGGAGCGTGATGGAGTCGTTCTGGTTGGTG
ACGCGGCTCACGCGCTGCCGCCCACATCAGGTCAAGGAACGTCGCAGGCCCTTGAAGATGCCGAGGCCTTAACTC
TGCTTCTCTGCTACTACCTAGGCGAGGCATACCGCGAGCGATTGGCACATGTCCAAGGGCAGAAGCAAGCAATCA
GAATGGCGGCCAAGAGGTATGAAAATCTGCGGTTACCCCGAGTAACCAAGATACTGCGAGATGCACAAAGCAGGC
AGAACACCAAGCGCAACAAGGGATTCATCGCCGAGAAGCTCATGTACTTGATGCTGTGGATAATTGGTAAGGTGA
TACCCTTTGGTGATTTGCAAAGCGAAACAGACTGATTGGCTTGTGCAGGATGGTTTCCGAGCCTCGTGATGAAAC
AAATGAGTACAGTCGTTGATTACAATGTAGCCCACGAGGTTAAGAAACTTGTTGAAAAGGAAAAGGAAACGGCAA
AGGAAAAAGAGGATTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail