Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|400
Gene name
LocationContig_1090:3723..5407
Strand-
Gene length (bp)1684
Transcript length (bp)1488
Coding sequence length (bp)1488
Protein length (aa) 496

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00134 Cyclin_N Cyclin, N-terminal domain 8.2E-44 231 357
PF02984 Cyclin_C Cyclin, C-terminal domain 1.9E-30 359 470

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P30284|CG21_EMENI G2/mitotic-specific cyclin-B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=nimE PE=2 SV=1 13 482 2.0E-164
sp|P10815|CG23_SCHPO G2/mitotic-specific cyclin cdc13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdc13 PE=1 SV=1 7 477 7.0E-117
sp|P24869|CG22_YEAST G2/mitotic-specific cyclin-2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CLB2 PE=1 SV=1 13 475 6.0E-99
sp|Q5ALY0|CG21_CANAL G2/mitotic-specific cyclin CLB2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CLB2 PE=1 SV=1 213 479 3.0E-92
sp|P47829|CG21_CANAX G2/mitotic-specific cyclin CYB1 OS=Candida albicans GN=CYB1 PE=2 SV=1 213 479 7.0E-91
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P30284|CG21_EMENI G2/mitotic-specific cyclin-B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=nimE PE=2 SV=1 13 482 2.0E-164
sp|P10815|CG23_SCHPO G2/mitotic-specific cyclin cdc13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdc13 PE=1 SV=1 7 477 7.0E-117
sp|P24869|CG22_YEAST G2/mitotic-specific cyclin-2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CLB2 PE=1 SV=1 13 475 6.0E-99
sp|Q5ALY0|CG21_CANAL G2/mitotic-specific cyclin CLB2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CLB2 PE=1 SV=1 213 479 3.0E-92
sp|P47829|CG21_CANAX G2/mitotic-specific cyclin CYB1 OS=Candida albicans GN=CYB1 PE=2 SV=1 213 479 7.0E-91
sp|P36630|CG22_SCHPO G2/mitotic-specific cyclin cig2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cig2 PE=1 SV=2 207 489 4.0E-89
sp|P24868|CG21_YEAST G2/mitotic-specific cyclin-1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CLB1 PE=1 SV=1 223 475 2.0E-85
sp|Q5A0A9|CG24_CANAL G2/mitotic-specific cyclin-4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CLB4 PE=1 SV=1 212 476 3.0E-79
sp|P24865|CG21_SCHPO G2/mitotic-specific cyclin cig1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cig1 PE=1 SV=2 221 475 2.0E-69
sp|P24871|CG24_YEAST G2/mitotic-specific cyclin-4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CLB4 PE=1 SV=2 217 474 3.0E-69
sp|P24870|CG23_YEAST G2/mitotic-specific cyclin-3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CLB3 PE=1 SV=3 226 474 4.0E-69
sp|O95067|CCNB2_HUMAN G2/mitotic-specific cyclin-B2 OS=Homo sapiens GN=CCNB2 PE=1 SV=1 213 481 5.0E-66
sp|Q60FX9|CCNB2_ANGJA G2/mitotic-specific cyclin-B2 OS=Anguilla japonica GN=ccnb2 PE=2 SV=1 213 470 6.0E-66
sp|P30276|CCNB2_MOUSE G2/mitotic-specific cyclin-B2 OS=Mus musculus GN=Ccnb2 PE=1 SV=2 213 481 2.0E-65
sp|Q4R7A8|CCNB2_MACFA G2/mitotic-specific cyclin-B2 OS=Macaca fascicularis GN=CCNB2 PE=2 SV=1 97 481 4.0E-65
sp|P37883|CCNB2_MESAU G2/mitotic-specific cyclin-B2 OS=Mesocricetus auratus GN=CCNB2 PE=2 SV=1 213 481 6.0E-65
sp|P32943|CGS6_YEAST S-phase entry cyclin-6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CLB6 PE=2 SV=2 213 450 1.0E-64
sp|O77689|CCNB2_BOVIN G2/mitotic-specific cyclin-B2 OS=Bos taurus GN=CCNB2 PE=2 SV=2 213 470 5.0E-64
sp|P13351|CCNB2_XENLA G2/mitotic-specific cyclin-B2 OS=Xenopus laevis GN=ccnb2 PE=1 SV=1 181 470 1.0E-63
sp|Q9IBG0|CCNB2_ORYLA G2/mitotic-specific cyclin-B2 OS=Oryzias latipes GN=ccnb2 PE=2 SV=1 114 470 3.0E-63
sp|P24862|CCNB_PATVU G2/mitotic-specific cyclin-B OS=Patella vulgata PE=2 SV=1 213 468 9.0E-63
sp|O93229|CCNB2_RANJA G2/mitotic-specific cyclin-B2 OS=Rana japonica GN=CCNB2 PE=2 SV=1 103 468 2.0E-62
sp|P51987|CCNB_HYDVD G2/mitotic-specific cyclin-B OS=Hydra viridissima PE=2 SV=1 144 468 2.0E-62
sp|Q9DG96|CCNB2_ORYLU G2/mitotic-specific cyclin-B2 OS=Oryzias luzonensis GN=ccnb2 PE=2 SV=1 114 470 8.0E-62
sp|P42524|CCNB_DICDI G2/mitotic-specific cyclin-B OS=Dictyostelium discoideum GN=cycB PE=1 SV=1 23 435 4.0E-61
sp|Q9DGA3|CCNB2_ORYCU G2/mitotic-specific cyclin-B2 OS=Oryzias curvinotus GN=ccnb2 PE=2 SV=1 114 470 7.0E-61
sp|P29332|CCNB2_CHICK G2/mitotic-specific cyclin-B2 OS=Gallus gallus GN=CCNB2 PE=2 SV=1 173 481 7.0E-61
sp|P15206|CCNB_MARGL G2/mitotic-specific cyclin-B OS=Marthasterias glacialis PE=2 SV=1 213 471 8.0E-61
sp|P14635|CCNB1_HUMAN G2/mitotic-specific cyclin-B1 OS=Homo sapiens GN=CCNB1 PE=1 SV=1 213 472 1.0E-60
sp|P37882|CCNB1_MESAU G2/mitotic-specific cyclin-B1 OS=Mesocricetus auratus GN=CCNB1 PE=2 SV=1 213 472 2.0E-60
sp|Q9DG99|CCNB2_ORYJA G2/mitotic-specific cyclin-B2 OS=Oryzias javanicus GN=ccnb2 PE=2 SV=1 213 470 5.0E-60
sp|P13952|CCNB_SPISO G2/mitotic-specific cyclin-B OS=Spisula solidissima PE=2 SV=1 213 471 8.0E-60
sp|Q08301|CCNB1_CRIGR G2/mitotic-specific cyclin-B1 OS=Cricetulus griseus GN=CCNB1 PE=2 SV=1 213 472 1.0E-59
sp|P24860|CCNB1_MOUSE G2/mitotic-specific cyclin-B1 OS=Mus musculus GN=Ccnb1 PE=1 SV=3 213 472 1.0E-59
sp|P07818|CCNB_ARBPU G2/mitotic-specific cyclin-B OS=Arbacia punctulata PE=2 SV=1 188 472 2.0E-59
sp|P30277|CCNB1_RAT G2/mitotic-specific cyclin-B1 OS=Rattus norvegicus GN=Ccnb1 PE=2 SV=1 213 472 2.0E-59
sp|Q1LZG6|CCNB1_BOVIN G2/mitotic-specific cyclin-B1 OS=Bos taurus GN=CCNB1 PE=2 SV=1 213 472 2.0E-58
sp|Q9DGA4|CCNB1_ORYCU G2/mitotic-specific cyclin-B1 OS=Oryzias curvinotus GN=ccnb1 PE=2 SV=1 213 439 2.0E-57
sp|P51988|CCNB_HYDVU G2/mitotic-specific cyclin-B (Fragment) OS=Hydra vulgaris PE=2 SV=1 142 470 3.0E-57
sp|P30283|CGS5_YEAST S-phase entry cyclin-5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CLB5 PE=1 SV=1 213 475 6.0E-57
sp|P13350|CCNB1_XENLA G2/mitotic-specific cyclin-B1 OS=Xenopus laevis GN=ccnb1 PE=1 SV=1 213 468 1.0E-56
sp|Q9DGA0|CCNB1_ORYJA G2/mitotic-specific cyclin-B1 OS=Oryzias javanicus GN=ccnb1 PE=2 SV=2 213 472 2.0E-55
sp|Q7XSJ6|CCB21_ORYSJ Cyclin-B2-1 OS=Oryza sativa subsp. japonica GN=CYCB2-1 PE=1 SV=2 207 464 2.0E-55
sp|Q01J96|CCB21_ORYSI Cyclin-B2-1 OS=Oryza sativa subsp. indica GN=CYCB2-1 PE=1 SV=1 207 464 2.0E-55
sp|Q9IBG1|CCNB1_ORYLA G2/mitotic-specific cyclin-B1 OS=Oryzias latipes GN=ccnb1 PE=2 SV=1 213 439 4.0E-55
sp|Q9DG97|CCNB1_ORYLU G2/mitotic-specific cyclin-B1 OS=Oryzias luzonensis GN=ccnb1 PE=2 SV=1 213 439 8.0E-55
sp|Q60FY0|CCNB1_ANGJA G2/mitotic-specific cyclin-B1 OS=Anguilla japonica GN=ccnb1 PE=2 SV=1 213 462 2.0E-53
sp|Q92162|CCNB1_CARAU G2/mitotic-specific cyclin-B1 OS=Carassius auratus GN=ccnb1 PE=2 SV=1 213 462 2.0E-52
sp|Q2QQ96|CCA21_ORYSJ Cyclin-A2-1 OS=Oryza sativa subsp. japonica GN=CYCA2-1 PE=2 SV=1 24 436 5.0E-52
sp|Q0D9C7|CCB22_ORYSJ Cyclin-B2-2 OS=Oryza sativa subsp. japonica GN=CYCB2-2 PE=1 SV=1 195 464 3.0E-51
sp|A2YH60|CCB22_ORYSI Cyclin-B2-2 OS=Oryza sativa subsp. indica GN=CYCB2-2 PE=1 SV=2 195 464 3.0E-51
sp|Q9FMH5|CCA31_ARATH Putative cyclin-A3-1 OS=Arabidopsis thaliana GN=CYCA3-1 PE=3 SV=1 212 470 6.0E-51
sp|P78396|CCNA1_HUMAN Cyclin-A1 OS=Homo sapiens GN=CCNA1 PE=1 SV=1 221 470 4.0E-50
sp|P46278|CCNB2_MEDSV G2/mitotic-specific cyclin-2 OS=Medicago sativa subsp. varia PE=2 SV=1 179 464 3.0E-49
sp|Q6AY13|CCNA1_RAT Cyclin-A1 OS=Rattus norvegicus GN=Ccna1 PE=2 SV=1 221 470 3.0E-49
sp|Q61456|CCNA1_MOUSE Cyclin-A1 OS=Mus musculus GN=Ccna1 PE=1 SV=2 221 470 4.0E-49
sp|P18063|CCNB_PATPE G2/mitotic-specific cyclin-B OS=Patiria pectinifera PE=2 SV=2 185 442 1.0E-48
sp|P30278|CCNB2_MEDSA G2/mitotic-specific cyclin-2 (Fragment) OS=Medicago sativa PE=2 SV=1 179 464 2.0E-48
sp|Q9FVX0|CCA12_ARATH Cyclin-A1-2 OS=Arabidopsis thaliana GN=CYCA1-2 PE=1 SV=2 212 464 3.0E-48
sp|P25011|CCNB1_SOYBN G2/mitotic-specific cyclin S13-6 OS=Glycine max PE=2 SV=1 206 445 4.0E-48
sp|P46277|CCNB1_MEDSV G2/mitotic-specific cyclin-1 OS=Medicago sativa subsp. varia PE=2 SV=1 182 464 5.0E-48
sp|Q9C6Y3|CCA11_ARATH Cyclin-A1-1 OS=Arabidopsis thaliana GN=CYCA1-1 PE=1 SV=1 207 435 2.0E-47
sp|Q0DH40|CCB15_ORYSJ Cyclin-B1-5 OS=Oryza sativa subsp. japonica GN=CYCB1-5 PE=3 SV=1 213 444 5.0E-47
sp|P39963|CCNB3_CHICK G2/mitotic-specific cyclin-B3 OS=Gallus gallus GN=CCNB3 PE=2 SV=1 202 440 8.0E-47
sp|P20439|CCNB_DROME G2/mitotic-specific cyclin-B OS=Drosophila melanogaster GN=CycB PE=1 SV=2 213 469 1.0E-46
sp|Q39067|CCB12_ARATH Cyclin-B1-2 OS=Arabidopsis thaliana GN=CYCB1-2 PE=1 SV=2 61 442 1.0E-46
sp|Q39069|CCB13_ARATH Cyclin-B1-3 OS=Arabidopsis thaliana GN=CYCB1-3 PE=2 SV=2 210 460 2.0E-46
sp|O48790|CCB14_ARATH Cyclin-B1-4 OS=Arabidopsis thaliana GN=CYCB1-4 PE=2 SV=1 212 435 4.0E-46
sp|P51986|CCNA_HYDVD G2/mitotic-specific cyclin-A (Fragment) OS=Hydra viridissima PE=2 SV=1 220 439 5.0E-46
sp|Q7F830|CCA11_ORYSJ Cyclin-A1-1 OS=Oryza sativa subsp. japonica GN=CYCA1-1 PE=2 SV=1 206 435 1.0E-45
sp|Q0JPA4|CCA12_ORYSJ Cyclin-A1-2 OS=Oryza sativa subsp. japonica GN=CYCA1-2 PE=3 SV=2 206 435 1.0E-45
sp|O14332|REM1_SCHPO Meiosis-specific cyclin rem1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rem1 PE=3 SV=1 221 492 2.0E-45
sp|P34800|CCN1_ANTMA G2/mitotic-specific cyclin-1 OS=Antirrhinum majus PE=2 SV=1 206 467 2.0E-45
sp|P43449|CCNA2_CHICK Cyclin-A2 OS=Gallus gallus GN=CCNA2 PE=2 SV=1 215 439 5.0E-45
sp|Q0INT0|CCA13_ORYSJ Cyclin-A1-3 OS=Oryza sativa subsp. japonica GN=CYCA1-3 PE=2 SV=2 206 435 6.0E-45
sp|Q9C6A9|CCA32_ARATH Cyclin-A3-2 OS=Arabidopsis thaliana GN=CYCA3-2 PE=2 SV=1 221 448 6.0E-45
sp|Q9LDM4|CCB23_ARATH Cyclin-B2-3 OS=Arabidopsis thaliana GN=CYCB2-3 PE=2 SV=2 194 468 1.0E-44
sp|A0MEB5|CCA33_ARATH Cyclin-A3-3 OS=Arabidopsis thaliana GN=CYCA3-3 PE=2 SV=2 224 448 2.0E-44
sp|P30183|CCB11_ARATH Cyclin-B1-1 OS=Arabidopsis thaliana GN=CYCB1-1 PE=1 SV=2 206 442 3.0E-44
sp|Q147G5|CCA22_ARATH Cyclin-A2-2 OS=Arabidopsis thaliana GN=CYCA2-2 PE=2 SV=1 228 444 7.0E-44
sp|Q39071|CCA21_ARATH Cyclin-A2-1 OS=Arabidopsis thaliana GN=CYCA2-1 PE=2 SV=3 156 430 1.0E-43
sp|Q9SFW6|CCB24_ARATH Cyclin-B2-4 OS=Arabidopsis thaliana GN=CYCB2-4 PE=2 SV=2 208 435 1.0E-43
sp|Q9C968|CCA24_ARATH Cyclin-A2-4 OS=Arabidopsis thaliana GN=CYCA2-4 PE=2 SV=1 212 444 4.0E-43
sp|P25012|CCNB2_SOYBN G2/mitotic-specific cyclin S13-7 (Fragment) OS=Glycine max PE=2 SV=1 231 445 5.0E-43
sp|Q9I7I0|CCNB3_DROME G2/mitotic-specific cyclin-B3 OS=Drosophila melanogaster GN=CycB3 PE=1 SV=1 213 430 6.0E-43
sp|Q0JIF2|CCB11_ORYSJ Cyclin-B1-1 OS=Oryza sativa subsp. japonica GN=CYCB1-1 PE=2 SV=2 213 443 7.0E-43
sp|P18606|CCNA1_XENLA Cyclin-A1 OS=Xenopus laevis GN=ccna1 PE=2 SV=1 221 470 8.0E-43
sp|P34801|CCN2_ANTMA G2/mitotic-specific cyclin-2 OS=Antirrhinum majus PE=2 SV=1 47 460 3.0E-42
sp|P51943|CCNA2_MOUSE Cyclin-A2 OS=Mus musculus GN=Ccna2 PE=1 SV=2 208 470 4.0E-42
sp|Q659K0|CCNB3_CANLF G2/mitotic-specific cyclin-B3 OS=Canis lupus familiaris GN=CCNB3 PE=2 SV=1 218 468 1.0E-41
sp|Q0DJR9|CCA14_ORYSJ Cyclin-A1-4 OS=Oryza sativa subsp. japonica GN=CYCA1-4 PE=2 SV=2 214 430 1.0E-41
sp|P24861|CCNA_PATVU G2/mitotic-specific cyclin-A OS=Patella vulgata PE=2 SV=1 225 464 1.0E-41
sp|P30274|CCNA2_BOVIN Cyclin-A2 OS=Bos taurus GN=CCNA2 PE=1 SV=2 207 470 2.0E-41
sp|P37881|CCNA2_MESAU Cyclin-A2 OS=Mesocricetus auratus GN=CCNA2 PE=2 SV=1 207 470 3.0E-41
sp|Q0JNK6|CCB13_ORYSJ Cyclin-B1-3 OS=Oryza sativa subsp. japonica GN=CYCB1-3 PE=2 SV=2 173 435 6.0E-41
sp|P20248|CCNA2_HUMAN Cyclin-A2 OS=Homo sapiens GN=CCNA2 PE=1 SV=2 207 470 7.0E-41
sp|P04962|CCNA_SPISO G2/mitotic-specific cyclin-A OS=Spisula solidissima PE=2 SV=1 205 430 8.0E-41
sp|Q3ECW2|CCA34_ARATH Cyclin-A3-4 OS=Arabidopsis thaliana GN=CYCA3-4 PE=1 SV=1 221 448 8.0E-41
sp|Q38819|CCA23_ARATH Cyclin-A2-3 OS=Arabidopsis thaliana GN=CYCA2-3 PE=1 SV=2 25 444 1.0E-40
sp|Q39070|CCB22_ARATH Cyclin-B2-2 OS=Arabidopsis thaliana GN=CYCB2-2 PE=1 SV=2 212 464 2.0E-40
sp|Q39068|CCB21_ARATH Cyclin-B2-1 OS=Arabidopsis thaliana GN=CYCB2-1 PE=1 SV=2 191 464 2.0E-40
sp|P25010|CCNAL_DAUCA G2/mitotic-specific cyclin C13-1 (Fragment) OS=Daucus carota PE=2 SV=1 217 444 6.0E-40
sp|P47827|CCNA2_XENLA Cyclin-A2 OS=Xenopus laevis GN=ccna2 PE=2 SV=1 225 446 2.0E-39
sp|Q92161|CCNA1_CARAU Cyclin-A1 OS=Carassius auratus GN=ccna1 PE=2 SV=1 221 470 3.0E-39
sp|Q8WWL7|CCNB3_HUMAN G2/mitotic-specific cyclin-B3 OS=Homo sapiens GN=CCNB3 PE=1 SV=2 217 439 5.0E-38
sp|P14785|CCNA_DROME G2/mitotic-specific cyclin-A OS=Drosophila melanogaster GN=CycA PE=1 SV=3 216 439 1.0E-36
sp|Q10653|CCNB1_CAEEL G2/mitotic-specific cyclin-B1 OS=Caenorhabditis elegans GN=cyb-1 PE=1 SV=1 229 411 2.0E-36
sp|Q75I54|CCA31_ORYSJ Cyclin-A3-1 OS=Oryza sativa subsp. japonica GN=CYCA3-1 PE=3 SV=1 224 444 5.0E-36
sp|Q810T2|CCNB3_MOUSE G2/mitotic-specific cyclin-B3 OS=Mus musculus GN=Ccnb3 PE=1 SV=2 220 468 2.0E-35
sp|Q10654|CCNB3_CAEEL G2/mitotic-specific cyclin-B3 OS=Caenorhabditis elegans GN=cyb-3 PE=2 SV=3 225 442 3.0E-35
sp|Q2QN26|CCA32_ORYSJ Cyclin-A3-2 OS=Oryza sativa subsp. japonica GN=CYCA3-2 PE=2 SV=1 227 396 7.0E-34
sp|Q9SA32|CCB31_ARATH Putative cyclin-B3-1 OS=Arabidopsis thaliana GN=CYCB3-1 PE=3 SV=2 217 445 7.0E-34
sp|P34638|CCNA1_CAEEL G2/mitotic-specific cyclin-A1 OS=Caenorhabditis elegans GN=cya-1 PE=1 SV=2 216 439 7.0E-34
sp|Q10Q63|CCF31_ORYSJ Putative cyclin-F3-1 OS=Oryza sativa subsp. japonica GN=CYCF3-1 PE=3 SV=1 222 416 5.0E-32
sp|Q10Q62|CCF32_ORYSJ Putative cyclin-F3-2 OS=Oryza sativa subsp. japonica GN=CYCF3-2 PE=3 SV=1 225 444 3.0E-29
sp|Q59YH3|CG11_CANAL G1/S-specific cyclin CCN1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CCN1 PE=1 SV=1 217 435 8.0E-28
sp|P0CY18|CG11_CANAX G1/S-specific cyclin CLN1 OS=Candida albicans GN=CLN1 PE=3 SV=1 217 435 9.0E-28
sp|C4YR54|CG11_CANAW G1/S-specific cyclin CCN1 OS=Candida albicans (strain WO-1) GN=CCN1 PE=3 SV=1 217 435 9.0E-28
sp|Q32NJ2|CCNOA_XENLA Cyclin-O protein A OS=Xenopus laevis GN=ccno-a PE=2 SV=1 144 443 5.0E-25
sp|Q32NM1|CCNOB_XENLA Cyclin-O protein B OS=Xenopus laevis GN=ccno-b PE=2 SV=1 227 462 3.0E-22
sp|Q9LM91|CCB25_ARATH Cyclin-B2-5 OS=Arabidopsis thaliana GN=CYCB2-5 PE=3 SV=2 286 445 9.0E-22
sp|Q9H8S5|CNTD2_HUMAN Cyclin N-terminal domain-containing protein 2 OS=Homo sapiens GN=CNTD2 PE=2 SV=2 227 392 1.0E-21
sp|Q9Z238|CCNE2_MOUSE G1/S-specific cyclin-E2 OS=Mus musculus GN=Ccne2 PE=1 SV=1 229 409 4.0E-21
sp|Q5E9K7|CCNE2_BOVIN G1/S-specific cyclin-E2 OS=Bos taurus GN=CCNE2 PE=2 SV=1 229 409 4.0E-21
sp|P22674|CCNO_HUMAN Cyclin-O OS=Homo sapiens GN=CCNO PE=1 SV=2 227 443 9.0E-21
sp|O96020|CCNE2_HUMAN G1/S-specific cyclin-E2 OS=Homo sapiens GN=CCNE2 PE=1 SV=1 229 409 3.0E-20
sp|O15995|CCNE_HEMPU G1/S-specific cyclin-E OS=Hemicentrotus pulcherrimus GN=CYCE PE=2 SV=1 259 408 3.0E-20
sp|P54733|CCNE_DROME G1/S-specific cyclin-E OS=Drosophila melanogaster GN=CycE PE=1 SV=2 256 384 8.0E-20
sp|P47794|CCNE1_DANRE G1/S-specific cyclin-E1 OS=Danio rerio GN=ccne1 PE=2 SV=1 255 408 1.0E-19
sp|Q39072|CCB15_ARATH Cyclin-B1-5 OS=Arabidopsis thaliana GN=CYCB1-5 PE=2 SV=3 212 371 2.0E-19
sp|P0C242|CCNO_MOUSE Cyclin-O OS=Mus musculus GN=Ccno PE=1 SV=1 227 415 2.0E-19
sp|P49707|CCNE1_CHICK G1/S-specific cyclin-E1 OS=Gallus gallus GN=CCNE1 PE=2 SV=1 231 445 2.0E-18
sp|O01501|CCNE_CAEEL G1/S-specific cyclin-E OS=Caenorhabditis elegans GN=cye-1 PE=2 SV=2 255 442 4.0E-17
sp|O42575|CCNE3_XENLA G1/S-specific cyclin-E3 OS=Xenopus laevis GN=cyce3 PE=2 SV=1 256 357 8.0E-17
sp|Q91780|CCNE2_XENLA G1/S-specific cyclin-E2 OS=Xenopus laevis GN=cyce2 PE=2 SV=1 261 357 5.0E-16
sp|P50756|CCNE1_XENLA G1/S-specific cyclin-E1 OS=Xenopus laevis GN=cyce1 PE=2 SV=1 261 357 5.0E-16
sp|P25009|PUC1_SCHPO Cyclin puc1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=puc1 PE=3 SV=1 225 365 5.0E-16
sp|P24864|CCNE1_HUMAN G1/S-specific cyclin-E1 OS=Homo sapiens GN=CCNE1 PE=1 SV=2 256 445 7.0E-16
sp|P39949|CCNE1_RAT G1/S-specific cyclin-E1 OS=Rattus norvegicus GN=Ccne1 PE=2 SV=2 256 445 3.0E-15
sp|Q6K1Z6|CCF21_ORYSJ Putative cyclin-F2-1 OS=Oryza sativa subsp. japonica GN=CycF2-1 PE=3 SV=2 224 439 4.0E-15
sp|Q61457|CCNE1_MOUSE G1/S-specific cyclin-E1 OS=Mus musculus GN=Ccne1 PE=1 SV=2 256 445 8.0E-15
sp|Q90459|CCND1_DANRE G1/S-specific cyclin-D1 OS=Danio rerio GN=ccnd1 PE=2 SV=1 232 408 2.0E-14
sp|P55169|CCND1_CHICK G1/S-specific cyclin-D1 OS=Gallus gallus GN=CCND1 PE=2 SV=1 232 428 3.0E-14
sp|P25322|CCND1_MOUSE G1/S-specific cyclin-D1 OS=Mus musculus GN=Ccnd1 PE=1 SV=1 232 427 5.0E-14
sp|P39948|CCND1_RAT G1/S-specific cyclin-D1 OS=Rattus norvegicus GN=Ccnd1 PE=2 SV=1 232 427 2.0E-13
sp|Q2KI22|CCND1_BOVIN G1/S-specific cyclin-D1 OS=Bos taurus GN=CCND1 PE=2 SV=1 232 365 5.0E-13
sp|Q10PQ9|CCSDS_ORYSJ Cyclin-SDS-like OS=Oryza sativa subsp. japonica GN=SDS PE=2 SV=1 261 401 1.0E-12
sp|Q0P5D3|CCND2_BOVIN G1/S-specific cyclin-D2 OS=Bos taurus GN=CCND2 PE=2 SV=1 201 409 1.0E-12
sp|P50755|CCND1_XENLA G1/S-specific cyclin-D1 OS=Xenopus laevis GN=ccnd1 PE=1 SV=1 232 408 1.0E-12
sp|Q64HP0|CCND1_CANLF G1/S-specific cyclin-D1 OS=Canis lupus familiaris GN=CCND1 PE=2 SV=1 232 365 2.0E-12
sp|Q5A1N6|CG13_CANAL G1/S-specific cyclin CLN3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CLN3 PE=1 SV=1 225 415 3.0E-12
sp|Q0J233|CCD21_ORYSJ Cyclin-D2-1 OS=Oryza sativa subsp. japonica GN=CYCD2-1 PE=3 SV=2 240 442 3.0E-12
sp|P30279|CCND2_HUMAN G1/S-specific cyclin-D2 OS=Homo sapiens GN=CCND2 PE=1 SV=1 201 409 4.0E-12
sp|Q8WNW2|CCND2_PIG G1/S-specific cyclin-D2 OS=Sus scrofa GN=CCND2 PE=2 SV=1 201 409 4.0E-12
sp|P49706|CCND2_CHICK G1/S-specific cyclin-D2 OS=Gallus gallus GN=CCND2 PE=3 SV=1 228 409 7.0E-12
sp|P43062|CG12_CANAX G1/S-specific cyclin CLN2 OS=Candida albicans GN=CLN2 PE=3 SV=1 225 415 9.0E-12
sp|Q04827|CCND2_RAT G1/S-specific cyclin-D2 OS=Rattus norvegicus GN=Ccnd2 PE=1 SV=1 232 409 1.0E-11
sp|P30280|CCND2_MOUSE G1/S-specific cyclin-D2 OS=Mus musculus GN=Ccnd2 PE=1 SV=1 232 409 1.0E-11
sp|Q0DWQ7|CCB12_ORYSJ Cyclin-B1-2 OS=Oryza sativa subsp. japonica GN=CYCB1-2 PE=3 SV=1 293 373 2.0E-11
sp|Q8MUK3|CCNE_CAEBR G1/S-specific cyclin-E OS=Caenorhabditis briggsae GN=cye-1 PE=2 SV=1 255 408 4.0E-11
sp|Q1PFW3|CCSDS_ARATH Cyclin-SDS OS=Arabidopsis thaliana GN=SDS PE=1 SV=2 259 411 6.0E-11
sp|Q5UPU3|YL268_MIMIV Putative serine/threonine-protein kinase L268 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L268 PE=3 SV=1 261 414 7.0E-11
sp|Q9Z2V9|CCNI_MOUSE Cyclin-I OS=Mus musculus GN=Ccni PE=2 SV=4 264 365 7.0E-11
sp|P53782|CCND2_XENLA G1/S-specific cyclin-D2 OS=Xenopus laevis GN=ccnd2 PE=2 SV=1 232 368 8.0E-11
sp|Q14094|CCNI_HUMAN Cyclin-I OS=Homo sapiens GN=CCNI PE=2 SV=1 264 365 9.0E-11
sp|Q7T0L6|CCNF_XENLA Cyclin-F OS=Xenopus laevis GN=ccnf PE=2 SV=1 261 480 1.0E-10
sp|Q6K8S0|CCF22_ORYSJ Cyclin-F2-2 OS=Oryza sativa subsp. japonica GN=CYCF2-2 PE=2 SV=1 224 439 2.0E-10
sp|Q3MHH5|CCND3_BOVIN G1/S-specific cyclin-D3 OS=Bos taurus GN=CCND3 PE=2 SV=1 232 439 3.0E-10
sp|P24385|CCND1_HUMAN G1/S-specific cyclin-D1 OS=Homo sapiens GN=CCND1 PE=1 SV=1 232 365 3.0E-10
sp|Q5ABE2|HGC1_CANAL Hypha-specific G1 cyclin-related protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=HGC1 PE=1 SV=1 220 352 3.0E-10
sp|Q5XGG5|CCNF_XENTR Cyclin-F OS=Xenopus tropicalis GN=ccnf PE=2 SV=1 261 480 3.0E-10
sp|P30281|CCND3_HUMAN G1/S-specific cyclin-D3 OS=Homo sapiens GN=CCND3 PE=1 SV=2 232 408 4.0E-10
sp|Q5R6J5|CCND1_PONAB G1/S-specific cyclin-D1 OS=Pongo abelii GN=CCND1 PE=2 SV=1 232 365 4.0E-10
sp|P41002|CCNF_HUMAN Cyclin-F OS=Homo sapiens GN=CCNF PE=1 SV=2 261 481 4.0E-10
sp|Q5SRT8|CCNJL_MOUSE Cyclin-J-like protein OS=Mus musculus GN=Ccnjl PE=2 SV=1 229 443 1.0E-09
sp|P30282|CCND3_MOUSE G1/S-specific cyclin-D3 OS=Mus musculus GN=Ccnd3 PE=1 SV=1 232 439 2.0E-09
sp|P48961|CCND3_RAT G1/S-specific cyclin-D3 OS=Rattus norvegicus GN=Ccnd3 PE=1 SV=1 232 429 2.0E-09
sp|P42752|CCD21_ARATH Cyclin-D2-1 OS=Arabidopsis thaliana GN=CYCD2-1 PE=1 SV=3 240 394 2.0E-09
sp|Q8LHA8|CCD22_ORYSJ Cyclin-D2-2 OS=Oryza sativa subsp. japonica GN=CYCD2-2 PE=2 SV=1 235 403 4.0E-09
sp|Q6NYX6|CCNF_DANRE Cyclin-F OS=Danio rerio GN=ccnf PE=2 SV=1 261 435 4.0E-09
sp|Q6DFJ9|CCNJ_XENLA Cyclin-J OS=Xenopus laevis GN=ccnj PE=2 SV=1 226 440 5.0E-09
sp|Q10QA2|CCD53_ORYSJ Cyclin-D5-3 OS=Oryza sativa subsp. japonica GN=CYCD5-3 PE=2 SV=1 261 412 5.0E-09
sp|Q6K8S1|CCF13_ORYSJ Putative cyclin-F1-3 OS=Oryza sativa subsp. japonica GN=CYCF1-3 PE=3 SV=1 224 430 6.0E-09
sp|Q6YXH8|CCD41_ORYSJ Cyclin-D4-1 OS=Oryza sativa subsp. japonica GN=CYCD4-1 PE=2 SV=2 236 386 9.0E-09
sp|A5PK16|CCNF_BOVIN Cyclin-F OS=Bos taurus GN=CCNF PE=2 SV=1 261 481 1.0E-08
sp|P51944|CCNF_MOUSE Cyclin-F OS=Mus musculus GN=Ccnf PE=2 SV=2 261 398 1.0E-08
sp|Q8K4F8|CCNF_RAT Cyclin-F OS=Rattus norvegicus GN=Ccnf PE=2 SV=2 261 398 2.0E-08
sp|Q9U2M5|CCND_CAEEL G1/S-specific cyclin-D OS=Caenorhabditis elegans GN=cyd-1 PE=1 SV=1 205 402 2.0E-08
sp|Q2V3B2|CCD51_ARATH Cyclin-D5-1 OS=Arabidopsis thaliana GN=CYCD5-1 PE=2 SV=2 243 381 3.0E-08
sp|Q5SCB5|CCND_OSTTA Cyclin-D OS=Ostreococcus tauri GN=CycD PE=3 SV=1 261 415 3.0E-08
sp|Q4KYM5|CCD42_ORYSJ Cyclin-D4-2 OS=Oryza sativa subsp. japonica GN=CYCD4-2 PE=2 SV=2 255 372 6.0E-08
sp|Q8H339|CCD12_ORYSJ Cyclin-D1-2 OS=Oryza sativa subsp. japonica GN=CYCD1-2 PE=3 SV=2 261 409 8.0E-08
sp|Q9SN11|CCD33_ARATH Cyclin-D3-3 OS=Arabidopsis thaliana GN=CYCD3-3 PE=2 SV=1 265 408 9.0E-08
sp|P42751|CCD11_ARATH Cyclin-D1-1 OS=Arabidopsis thaliana GN=CYCD1-1 PE=1 SV=3 244 411 3.0E-07
sp|Q3TZI6|CCNJ_MOUSE Cyclin-J OS=Mus musculus GN=Ccnj PE=2 SV=2 222 443 5.0E-07
sp|P42753|CCD31_ARATH Cyclin-D3-1 OS=Arabidopsis thaliana GN=CYCD3-1 PE=1 SV=3 265 408 1.0E-06
sp|Q9FGQ7|CCD32_ARATH Cyclin-D3-2 OS=Arabidopsis thaliana GN=CYCD3-2 PE=2 SV=1 265 411 2.0E-06
sp|Q0WQN9|CCD42_ARATH Cyclin-D4-2 OS=Arabidopsis thaliana GN=CYCD4-2 PE=1 SV=2 245 407 2.0E-06
sp|P30286|CCNB1_MEDSA G2/mitotic-specific cyclin-1 (Fragment) OS=Medicago sativa PE=2 SV=1 208 269 3.0E-06
sp|Q7TMA5|APOB_RAT Apolipoprotein B-100 OS=Rattus norvegicus GN=Apob PE=1 SV=1 253 390 3.0E-06
sp|Q9LZM0|CCD71_ARATH Putative cyclin-D7-1 OS=Arabidopsis thaliana GN=CYCD7-1 PE=3 SV=1 267 486 4.0E-06
sp|Q06374|CG1_COLGL Putative G1/S-specific cyclin OS=Colletotrichum gloeosporioides GN=CYC1 PE=2 SV=1 227 404 6.0E-06
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4885
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|400 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|2602
Ophiocordyceps camponoti-floridani Ophcf2|04385
Ophiocordyceps camponoti-rufipedis Ophun1|7209
Ophiocordyceps kimflemingae Ophio5|5961
Ophiocordyceps subramaniannii Hirsu2|11230

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|400
MPPGRPRSHLTSNDHDENSTSTTRMTRAKAAALHADELSLPSKSAVQSRKTANTGNVAPQRKRTALGDVSNFGKN
EGEAKKGLVSKTAYPTGVQKKMSRPNGRTALASKDTNKAEAVQKSGSGAGTLAAGPKRKASSTLSAIIKQDSGPE
EEVEPVRKRVHTSLTEKHIRAEAPVQAAANVLASADHIKSPSPEMHEPLREQEPLREQERPLNLDKEDRHDQFMV
AEYATDIFEYLRKLEVKTIPNSDYMIHQDDLEWKTRAILIDWLIEVHTRFHLLPETLFLAVNIIDRFLSLKVVQL
DRLQLVGITAMFIASKYEEVLSPHVENFKRITDNGFNEAEILSAERFILTTLNYDLSYPSPMNFLRRISKADNYN
IQSRTVSKYLMEISLLDHRFMSIRSSLIAAAAMCLARLMLSRGEWNVTLAHYAGYAEEEIEPVLELMVDYLVRPI
IHEGLFKKYAGKRFLKASIMARGWAKRYHDVFGVEDSNIPLDQVD*
Coding >OphauG2|400
ATGCCTCCTGGTCGTCCCCGTTCACATCTCACGTCTAATGATCACGACGAGAATAGCACGTCAACAACACGCATG
ACACGGGCCAAGGCTGCTGCTCTTCATGCTGATGAGCTTTCATTGCCCTCAAAATCCGCTGTTCAGTCCCGTAAG
ACGGCAAACACCGGCAATGTTGCCCCACAGCGCAAACGCACAGCACTCGGCGATGTCAGCAACTTTGGCAAGAAT
GAAGGAGAGGCCAAAAAGGGTCTTGTATCAAAGACTGCTTATCCCACTGGAGTCCAGAAGAAGATGTCGCGCCCA
AATGGCCGCACCGCCTTGGCATCCAAAGATACCAACAAGGCCGAAGCTGTCCAGAAATCTGGCTCTGGTGCTGGC
ACTCTCGCTGCCGGTCCCAAGCGTAAAGCCTCATCCACCCTCTCTGCCATTATCAAACAAGACTCGGGCCCTGAA
GAAGAAGTTGAACCTGTACGCAAAAGGGTACACACTTCTCTTACTGAAAAGCACATCCGCGCAGAAGCGCCTGTC
CAAGCCGCTGCCAATGTCCTTGCATCAGCGGATCATATCAAATCTCCATCTCCTGAAATGCATGAGCCTCTGAGG
GAGCAAGAACCTCTGAGAGAGCAAGAGCGTCCTTTAAACTTGGACAAGGAAGATCGCCATGACCAGTTCATGGTC
GCCGAATACGCGACGGATATTTTTGAGTATCTTCGCAAGCTCGAAGTGAAGACAATTCCCAACTCGGATTACATG
ATTCATCAAGATGACTTGGAATGGAAGACTAGGGCCATTCTTATTGATTGGCTCATTGAAGTTCACACTCGATTT
CATCTTCTACCAGAGACTCTCTTCCTTGCCGTCAACATCATAGATCGGTTTTTGTCACTCAAGGTTGTGCAGCTT
GACCGCTTGCAGCTCGTCGGTATTACTGCAATGTTCATTGCATCCAAGTACGAAGAGGTCCTCTCACCTCATGTG
GAGAATTTCAAGCGCATCACCGACAATGGGTTTAATGAGGCTGAAATCCTCAGTGCCGAACGCTTCATTCTGACC
ACGTTGAACTATGATTTGAGCTATCCCAGTCCCATGAATTTCTTGCGTCGGATCTCGAAGGCGGACAACTATAAT
ATCCAGTCTCGTACTGTTAGCAAGTACCTCATGGAGATCAGTTTGCTTGACCACCGCTTCATGTCAATCCGATCC
AGTCTCATAGCAGCTGCCGCGATGTGTCTAGCGCGGCTCATGCTAAGCAGAGGCGAATGGAATGTGACTCTTGCC
CACTATGCAGGCTACGCAGAGGAAGAAATTGAGCCAGTTCTTGAACTCATGGTTGACTATCTGGTACGCCCTATC
ATACACGAGGGACTTTTCAAGAAGTATGCTGGCAAGAGATTTCTTAAAGCTTCAATCATGGCTCGTGGGTGGGCG
AAGCGTTATCACGATGTCTTTGGCGTCGAAGACAGCAATATACCCCTGGACCAAGTCGATTAA
Transcript >OphauG2|400
ATGCCTCCTGGTCGTCCCCGTTCACATCTCACGTCTAATGATCACGACGAGAATAGCACGTCAACAACACGCATG
ACACGGGCCAAGGCTGCTGCTCTTCATGCTGATGAGCTTTCATTGCCCTCAAAATCCGCTGTTCAGTCCCGTAAG
ACGGCAAACACCGGCAATGTTGCCCCACAGCGCAAACGCACAGCACTCGGCGATGTCAGCAACTTTGGCAAGAAT
GAAGGAGAGGCCAAAAAGGGTCTTGTATCAAAGACTGCTTATCCCACTGGAGTCCAGAAGAAGATGTCGCGCCCA
AATGGCCGCACCGCCTTGGCATCCAAAGATACCAACAAGGCCGAAGCTGTCCAGAAATCTGGCTCTGGTGCTGGC
ACTCTCGCTGCCGGTCCCAAGCGTAAAGCCTCATCCACCCTCTCTGCCATTATCAAACAAGACTCGGGCCCTGAA
GAAGAAGTTGAACCTGTACGCAAAAGGGTACACACTTCTCTTACTGAAAAGCACATCCGCGCAGAAGCGCCTGTC
CAAGCCGCTGCCAATGTCCTTGCATCAGCGGATCATATCAAATCTCCATCTCCTGAAATGCATGAGCCTCTGAGG
GAGCAAGAACCTCTGAGAGAGCAAGAGCGTCCTTTAAACTTGGACAAGGAAGATCGCCATGACCAGTTCATGGTC
GCCGAATACGCGACGGATATTTTTGAGTATCTTCGCAAGCTCGAAGTGAAGACAATTCCCAACTCGGATTACATG
ATTCATCAAGATGACTTGGAATGGAAGACTAGGGCCATTCTTATTGATTGGCTCATTGAAGTTCACACTCGATTT
CATCTTCTACCAGAGACTCTCTTCCTTGCCGTCAACATCATAGATCGGTTTTTGTCACTCAAGGTTGTGCAGCTT
GACCGCTTGCAGCTCGTCGGTATTACTGCAATGTTCATTGCATCCAAGTACGAAGAGGTCCTCTCACCTCATGTG
GAGAATTTCAAGCGCATCACCGACAATGGGTTTAATGAGGCTGAAATCCTCAGTGCCGAACGCTTCATTCTGACC
ACGTTGAACTATGATTTGAGCTATCCCAGTCCCATGAATTTCTTGCGTCGGATCTCGAAGGCGGACAACTATAAT
ATCCAGTCTCGTACTGTTAGCAAGTACCTCATGGAGATCAGTTTGCTTGACCACCGCTTCATGTCAATCCGATCC
AGTCTCATAGCAGCTGCCGCGATGTGTCTAGCGCGGCTCATGCTAAGCAGAGGCGAATGGAATGTGACTCTTGCC
CACTATGCAGGCTACGCAGAGGAAGAAATTGAGCCAGTTCTTGAACTCATGGTTGACTATCTGGTACGCCCTATC
ATACACGAGGGACTTTTCAAGAAGTATGCTGGCAAGAGATTTCTTAAAGCTTCAATCATGGCTCGTGGGTGGGCG
AAGCGTTATCACGATGTCTTTGGCGTCGAAGACAGCAATATACCCCTGGACCAAGTCGATTAA
Gene >OphauG2|400
ATGCCTCCTGTGAGAATCTTGTCCTCTTGTCGCGCACTATGTGCCTCGTTTTCGTGAATTGATCTGACTGACTCT
CTGCCAAGGGTCGTCCCCGTTCACATCTCACGTCTAATGATCACGACGAGAATAGCACGTCAACAACACGCATGA
CACGGGCCAAGGCTGCTGCTCTTCATGCTGATGAGCTTTCATTGCCCTCAAAATCCGCTGTTCAGTCCCGTAAGA
CGGCAAACACCGGCAATGTTGCCCCACAGCGCAAACGCACAGCACTCGGCGATGTCAGCAACTTTGGCAAGAATG
AAGGAGAGGCCAAAAAGGGTCTTGTATCAAAGACTGCTTATCCCACTGGAGTCCAGAAGAAGATGTCGCGCCCAA
ATGGCCGCACCGCCTTGGCATCCAAAGATACCAACAAGGCCGAAGCTGTCCAGAAATCTGGCTCTGGTGCTGGCA
CTCTCGCTGCCGGTCCCAAGCGTAAAGCCTCATCCACCCTCTCTGCCATTATCAAACAAGACTCGGGCCCTGAAG
AAGAAGTTGAACCTGTACGCAAAAGGGTACACACTTCTCTTACTGAAAAGCACATCCGCGCAGAAGCGCCTGTCC
AAGCCGCTGCCAATGTCCTTGCATCAGCGGATCATATCAAATCTCCATCTCCTGAAATGCATGAGCCTCTGAGGG
AGCAAGAACCTCTGAGAGAGCAAGAGCGTCCTTTAAACTTGGACAAGGAAGATCGCCATGACCAGTTCATGGTCG
CCGAATACGCGACGGATATTTTTGAGTATCTTCGCAAGCTCGAAGTGAAGACAATTCCCAACTCGGATTACATGA
TTCATCAAGATGACTTGGAATGGAAGACTAGGGCCATTCTTATTGATTGGCTCATTGAAGTTCACACTCGATTTC
ATCTTCTACCAGAGACTCTCTTCCTTGCCGTCAACATCATAGATCGGTTTTTGTCACTCAAGGTTGTGCAGCTTG
ACCGCTTGCAGCTCGTCGGTATTACTGCAATGTTCATTGCATCCAAGTACGAAGAGGTCCTCTCACCTCATGTGG
AGAATTTCAAGCGCATCACCGACAATGGGTTTAATGAGGCTGAAATCCTCAGTGCCGAACGCTTCATTCTGACCA
CGTTGAACTATGATTTGAGCTATCCCAGTCCCATGAATTTCTTGCGTCGGATCTCGAAGGCGGACAACTATAATA
TCCAGTCTCGTACTGTTAGCAAGTACCTCATGGAGATCAGTTTGCTTGACCACCGCTTCATGTCAATCCGATCCA
GTCTCATAGCAGCTGCCGCGATGTGTCTAGCGCGGCTCATGCTAAGCAGAGGCGAATGGGTAGGCTTATGCATTA
TCAACTGTGAAAAGTAACCATACGACGCTAATTAGAGACTTGCCTACAGAATGTGACTCTTGCCCACTATGCAGG
CTACGCAGAGGAAGAAATTGAGCCAGTTCTTGAACTCATGGTTGACTATCTGGTACGCCCTATCATACACGAGGG
ACTTTTCAAGAAGTATGCTGGCAAGAGATTTCTTAAAGGTGAATACGTGGCGCCTCTCTTGTGTTGAGTGTTTAA
TTCGAAGCTGACAGTAATAGCTTCAATCATGGCTCGTGGGTGGGCGAAGCGTTATCACGATGTCTTTGGCGTCGA
AGACAGCAATATACCCCTGGACCAAGTCGATTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail