Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|3990
Gene name
LocationContig_317:10430..11480
Strand-
Gene length (bp)1050
Transcript length (bp)882
Coding sequence length (bp)882
Protein length (aa) 294

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 7.6E-10 18 83
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 4.1E-09 151 219

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P49314|ROC2_NICPL 31 kDa ribonucleoprotein, chloroplastic OS=Nicotiana plumbaginifolia PE=2 SV=1 2 219 2.0E-08
sp|Q08937|ROC2_NICSY 29 kDa ribonucleoprotein B, chloroplastic OS=Nicotiana sylvestris PE=2 SV=1 2 219 2.0E-08
sp|P52299|NCBP2_XENLA Nuclear cap-binding protein subunit 2 OS=Xenopus laevis GN=ncbp2 PE=2 SV=2 6 121 2.0E-07
sp|B1WC40|NCBP2_RAT Nuclear cap-binding protein subunit 2 OS=Rattus norvegicus GN=Ncbp2 PE=1 SV=1 3 121 4.0E-07
sp|Q9CQ49|NCBP2_MOUSE Nuclear cap-binding protein subunit 2 OS=Mus musculus GN=Ncbp2 PE=1 SV=1 3 121 4.0E-07
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P49314|ROC2_NICPL 31 kDa ribonucleoprotein, chloroplastic OS=Nicotiana plumbaginifolia PE=2 SV=1 2 219 2.0E-08
sp|Q08937|ROC2_NICSY 29 kDa ribonucleoprotein B, chloroplastic OS=Nicotiana sylvestris PE=2 SV=1 2 219 2.0E-08
sp|P52299|NCBP2_XENLA Nuclear cap-binding protein subunit 2 OS=Xenopus laevis GN=ncbp2 PE=2 SV=2 6 121 2.0E-07
sp|B1WC40|NCBP2_RAT Nuclear cap-binding protein subunit 2 OS=Rattus norvegicus GN=Ncbp2 PE=1 SV=1 3 121 4.0E-07
sp|Q9CQ49|NCBP2_MOUSE Nuclear cap-binding protein subunit 2 OS=Mus musculus GN=Ncbp2 PE=1 SV=1 3 121 4.0E-07
sp|P52298|NCBP2_HUMAN Nuclear cap-binding protein subunit 2 OS=Homo sapiens GN=NCBP2 PE=1 SV=1 3 121 4.0E-07
sp|Q3ZBJ1|NCBP2_BOVIN Nuclear cap-binding protein subunit 2 OS=Bos taurus GN=NCBP2 PE=2 SV=1 3 121 4.0E-07
sp|A2SW84|NCBP2_SINCH Nuclear cap-binding protein subunit 2 OS=Siniperca chuatsi GN=ncbp2 PE=2 SV=1 1 89 5.0E-07
sp|Q6DES0|NCBP2_XENTR Nuclear cap-binding protein subunit 2 OS=Xenopus tropicalis GN=ncbp2 PE=2 SV=1 6 121 6.0E-07
sp|F4I3B3|RB47A_ARATH Polyadenylate-binding protein RBP47A OS=Arabidopsis thaliana GN=RBP47A PE=2 SV=1 18 228 1.0E-06
sp|Q5RC80|RBM39_PONAB RNA-binding protein 39 OS=Pongo abelii GN=RBM39 PE=2 SV=1 17 91 1.0E-06
sp|Q14498|RBM39_HUMAN RNA-binding protein 39 OS=Homo sapiens GN=RBM39 PE=1 SV=2 17 91 1.0E-06
sp|Q8VH51|RBM39_MOUSE RNA-binding protein 39 OS=Mus musculus GN=Rbm39 PE=1 SV=2 17 91 1.0E-06
sp|Q9FPJ8|RB45A_ARATH Polyadenylate-binding protein RBP45A OS=Arabidopsis thaliana GN=RBP45A PE=2 SV=1 18 219 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:0003674 molecular_function No
GO:1901363 heterocyclic compound binding No
GO:0005488 binding No
GO:0003676 nucleic acid binding No
GO:0097159 organic cyclic compound binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|3990
MEADSPDQPDALAQGRRIYLGNLLYRIKPQHVEQVLVEKGFGDFEKIHISIDPVSARNPGYCFIDFADRSTAQRA
LSSLNATIEGRPIRVGPCEPKKQRSQSGGRFAFQRWGDWGAGAGDHENSSTGSQQGPHGALEHFVDMAQGQRGRR
LYVGGLGKMIDQAQNNQEISDIFADFNPTAIGKRITPMPGHQHYCFVDFETKEEALAAIQALNGKPLEGGGRLKV
RLANNFPTRLDRLPADQHQHATRTPQAASWRSKDSRSTNTGEANSRAMASNDWRRKDANEHAKTRPST*
Coding >OphauG2|3990
ATGGAGGCCGACTCGCCAGATCAACCCGATGCCTTGGCCCAAGGCCGCCGCATCTACCTGGGCAATCTCTTGTAC
AGAATCAAGCCGCAGCACGTCGAGCAAGTGCTGGTTGAAAAGGGCTTTGGCGACTTTGAAAAGATTCACATCTCC
ATCGACCCTGTCAGTGCGCGCAACCCGGGCTACTGCTTCATCGACTTTGCCGACCGCTCAACCGCCCAGCGCGCC
CTCTCGTCCCTCAATGCCACCATTGAGGGCCGGCCCATCAGGGTTGGGCCCTGTGAGCCCAAGAAGCAGCGCAGC
CAGAGTGGCGGCCGCTTTGCCTTCCAGCGATGGGGCGACTGGGGCGCCGGCGCCGGCGACCACGAGAACTCATCA
ACCGGCTCTCAGCAGGGGCCTCACGGGGCTCTCGAGCACTTTGTCGACATGGCTCAGGGCCAGCGAGGACGAAGG
CTATACGTCGGCGGCCTGGGCAAGATGATTGACCAGGCCCAGAACAACCAAGAGATTAGCGATATTTTTGCCGAT
TTCAACCCCACCGCAATTGGCAAACGCATCACCCCCATGCCGGGCCATCAACATTACTGCTTCGTCGACTTTGAA
ACAAAAGAGGAGGCTCTAGCCGCCATACAAGCCCTCAACGGCAAGCCCTTAGAGGGAGGAGGGAGGCTCAAGGTC
AGGCTGGCCAATAACTTTCCAACCCGACTGGATCGTCTTCCCGCCGACCAGCACCAACACGCCACCCGCACACCC
CAGGCAGCTTCTTGGCGCTCCAAGGACTCGCGTTCCACAAATACAGGCGAAGCCAACAGCAGAGCCATGGCGTCC
AATGATTGGCGCAGAAAAGACGCCAATGAGCACGCCAAGACAAGGCCCAGCACGTAG
Transcript >OphauG2|3990
ATGGAGGCCGACTCGCCAGATCAACCCGATGCCTTGGCCCAAGGCCGCCGCATCTACCTGGGCAATCTCTTGTAC
AGAATCAAGCCGCAGCACGTCGAGCAAGTGCTGGTTGAAAAGGGCTTTGGCGACTTTGAAAAGATTCACATCTCC
ATCGACCCTGTCAGTGCGCGCAACCCGGGCTACTGCTTCATCGACTTTGCCGACCGCTCAACCGCCCAGCGCGCC
CTCTCGTCCCTCAATGCCACCATTGAGGGCCGGCCCATCAGGGTTGGGCCCTGTGAGCCCAAGAAGCAGCGCAGC
CAGAGTGGCGGCCGCTTTGCCTTCCAGCGATGGGGCGACTGGGGCGCCGGCGCCGGCGACCACGAGAACTCATCA
ACCGGCTCTCAGCAGGGGCCTCACGGGGCTCTCGAGCACTTTGTCGACATGGCTCAGGGCCAGCGAGGACGAAGG
CTATACGTCGGCGGCCTGGGCAAGATGATTGACCAGGCCCAGAACAACCAAGAGATTAGCGATATTTTTGCCGAT
TTCAACCCCACCGCAATTGGCAAACGCATCACCCCCATGCCGGGCCATCAACATTACTGCTTCGTCGACTTTGAA
ACAAAAGAGGAGGCTCTAGCCGCCATACAAGCCCTCAACGGCAAGCCCTTAGAGGGAGGAGGGAGGCTCAAGGTC
AGGCTGGCCAATAACTTTCCAACCCGACTGGATCGTCTTCCCGCCGACCAGCACCAACACGCCACCCGCACACCC
CAGGCAGCTTCTTGGCGCTCCAAGGACTCGCGTTCCACAAATACAGGCGAAGCCAACAGCAGAGCCATGGCGTCC
AATGATTGGCGCAGAAAAGACGCCAATGAGCACGCCAAGACAAGGCCCAGCACGTAG
Gene >OphauG2|3990
ATGGAGGCCGACTCGCCAGATCAACCCGATGCCTTGGCCCAAGGCCGCCGCATCTACCTGGGTGCAGTCACCTGT
TGCGCCTCATGAGATGCTGTAACCGCCGCTAACGCCCCAGTCCCGAGACAGGCAATCTCTTGTACAGAATCAAGC
CGCAGCACGTCGAGCAAGTGCTGGTTGAAAAGGGCTTTGGCGACTTTGAAAAGATTCACATCTCCATCGACCCTG
TCAGTGCGCGCAACCCGGGCTACTGCTTCATCGACTTTGCCGACCGCTCAACCGCCCAGCGCGCCCTCTCGTCCC
TCAATGCCACCATTGAGGGCCGGCCCATCAGGGTTGGGCCCTGTGAGCCCAAGAAGCAGCGCAGCCAGAGTGGCG
GCCGCTTTGCCTTCCAGCGATGGGGCGACTGGGGCGCCGGCGCCGGCGACCACGAGAACTCATCAACCGGCTCTC
AGCAGGGGCCTCACGGGGCTCTCGAGCACTTTGTCGACATGGCTCAGGGCCAGCGAGGACGAAGGCTATACGTCG
GCGGCCTGGGCAAGATGATTGACCAGGCCCAGAACAACCAAGAGATTAGCGATATTTTTGCCGATTTCAACCCGT
GAGTCGTCTCCCTGGCACTTCTTGTCTACCTCGTCTCCTCTGCCTCGTCTCCTCTGCCTCGTCTCCTCCCACTAA
TTGCTCGTCGCAACACACTGCTCCAGCACCGCAATTGGCAAACGCATCACCCCCATGCCGGGCCATCAACATTAC
TGCTTCGTCGACTTTGAAACAAAAGAGGAGGCTCTAGCCGCCATACAAGCCCTCAACGGCAAGCCCTTAGAGGGA
GGAGGGAGGCTCAAGGTCAGGCTGGCCAATAACTTTCCAACCCGACTGGATCGTCTTCCCGCCGACCAGCACCAA
CACGCCACCCGCACACCCCAGGCAGCTTCTTGGCGCTCCAAGGACTCGCGTTCCACAAATACAGGCGAAGCCAAC
AGCAGAGCCATGGCGTCCAATGATTGGCGCAGAAAAGACGCCAATGAGCACGCCAAGACAAGGCCCAGCACGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail