Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|3984
Gene name
LocationContig_316:10825..12004
Strand-
Gene length (bp)1179
Transcript length (bp)1179
Coding sequence length (bp)1179
Protein length (aa) 393

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00626 Gelsolin Gelsolin repeat 1.4E-12 61 145
PF00626 Gelsolin Gelsolin repeat 9.8E-11 190 255

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P10733|SEVE_DICDI Severin OS=Dictyostelium discoideum GN=sevA PE=1 SV=1 7 385 1.0E-76
sp|Q7JQD3|GELS1_LUMTE Gelsolin-like protein 1 OS=Lumbricus terrestris GN=AM PE=1 SV=1 6 385 3.0E-72
sp|Q8MPM1|GELS2_LUMTE Gelsolin-like protein 2 OS=Lumbricus terrestris GN=gelsolin PE=1 SV=1 6 389 1.0E-66
sp|Q24800|SEVE_ECHGR Severin OS=Echinococcus granulosus GN=AG8 PE=2 SV=3 6 362 3.0E-60
sp|Q07171|GELS_DROME Gelsolin OS=Drosophila melanogaster GN=Gel PE=1 SV=2 48 385 5.0E-52
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P10733|SEVE_DICDI Severin OS=Dictyostelium discoideum GN=sevA PE=1 SV=1 7 385 1.0E-76
sp|Q7JQD3|GELS1_LUMTE Gelsolin-like protein 1 OS=Lumbricus terrestris GN=AM PE=1 SV=1 6 385 3.0E-72
sp|Q8MPM1|GELS2_LUMTE Gelsolin-like protein 2 OS=Lumbricus terrestris GN=gelsolin PE=1 SV=1 6 389 1.0E-66
sp|Q24800|SEVE_ECHGR Severin OS=Echinococcus granulosus GN=AG8 PE=2 SV=3 6 362 3.0E-60
sp|Q07171|GELS_DROME Gelsolin OS=Drosophila melanogaster GN=Gel PE=1 SV=2 48 385 5.0E-52
sp|O93510|GELS_CHICK Gelsolin OS=Gallus gallus GN=GSN PE=2 SV=1 48 385 5.0E-51
sp|O61270|GELS_HALRO Gelsolin, cytoplasmic OS=Halocynthia roretzi PE=1 SV=1 48 385 2.0E-50
sp|Q3SX14|GELS_BOVIN Gelsolin OS=Bos taurus GN=GSN PE=2 SV=1 48 385 1.0E-49
sp|P20305|GELS_PIG Gelsolin (Fragment) OS=Sus scrofa GN=GSN PE=1 SV=1 48 385 1.0E-48
sp|P06396|GELS_HUMAN Gelsolin OS=Homo sapiens GN=GSN PE=1 SV=1 48 385 1.0E-48
sp|Q27319|GELS_HOMAM Gelsolin, cytoplasmic OS=Homarus americanus PE=1 SV=1 48 385 3.0E-48
sp|Q28372|GELS_HORSE Gelsolin OS=Equus caballus GN=GSN PE=1 SV=2 48 385 8.0E-48
sp|P02640|VILI_CHICK Villin-1 OS=Gallus gallus GN=VIL1 PE=1 SV=2 50 385 1.0E-47
sp|P13020|GELS_MOUSE Gelsolin OS=Mus musculus GN=Gsn PE=1 SV=3 48 385 3.0E-47
sp|Q68FP1|GELS_RAT Gelsolin OS=Rattus norvegicus GN=Gsn PE=1 SV=1 48 385 7.0E-47
sp|Q62468|VILI_MOUSE Villin-1 OS=Mus musculus GN=Vil1 PE=1 SV=3 50 383 1.0E-46
sp|Q9Y6U3|ADSV_HUMAN Adseverin OS=Homo sapiens GN=SCIN PE=1 SV=4 48 385 5.0E-46
sp|O75366|AVIL_HUMAN Advillin OS=Homo sapiens GN=AVIL PE=1 SV=3 46 385 3.0E-45
sp|P09327|VILI_HUMAN Villin-1 OS=Homo sapiens GN=VIL1 PE=1 SV=4 50 385 3.0E-45
sp|Q3SZP7|VILI_BOVIN Villin-1 OS=Bos taurus GN=VIL1 PE=2 SV=3 50 385 4.0E-45
sp|Q5ZIV9|ADSV_CHICK Adseverin OS=Gallus gallus GN=SCIN PE=2 SV=2 48 385 4.0E-45
sp|Q29261|VILI_PIG Villin-1 OS=Sus scrofa GN=VIL1 PE=2 SV=2 50 385 1.0E-44
sp|O88398|AVIL_MOUSE Advillin OS=Mus musculus GN=Avil PE=1 SV=2 46 385 6.0E-44
sp|Q9WU06|AVIL_RAT Advillin OS=Rattus norvegicus GN=Avil PE=2 SV=1 46 385 2.0E-43
sp|Q60604|ADSV_MOUSE Adseverin OS=Mus musculus GN=Scin PE=1 SV=3 48 385 4.0E-43
sp|O65570|VILI4_ARATH Villin-4 OS=Arabidopsis thaliana GN=VLN4 PE=1 SV=1 39 390 6.0E-43
sp|Q28046|ADSV_BOVIN Adseverin OS=Bos taurus GN=SCIN PE=1 SV=1 48 385 2.0E-42
sp|O81644|VILI2_ARATH Villin-2 OS=Arabidopsis thaliana GN=VLN2 PE=1 SV=2 39 385 5.0E-42
sp|O81645|VILI3_ARATH Villin-3 OS=Arabidopsis thaliana GN=VLN3 PE=1 SV=2 39 385 1.0E-41
sp|Q21253|GELS1_CAEEL Gelsolin-like protein 1 OS=Caenorhabditis elegans GN=gsnl-1 PE=1 SV=1 47 385 3.0E-41
sp|Q9LVC6|VILI5_ARATH Villin-5 OS=Arabidopsis thaliana GN=VLN5 PE=2 SV=1 48 385 2.0E-40
sp|P24452|CAPG_MOUSE Macrophage-capping protein OS=Mus musculus GN=Capg PE=1 SV=2 52 385 9.0E-40
sp|A8XV95|GELS1_CAEBR Gelsolin-like protein 1 OS=Caenorhabditis briggsae GN=gsnl-1 PE=3 SV=1 47 385 1.0E-39
sp|Q6AYC4|CAPG_RAT Macrophage-capping protein OS=Rattus norvegicus GN=Capg PE=1 SV=1 52 385 2.0E-39
sp|P40121|CAPG_HUMAN Macrophage-capping protein OS=Homo sapiens GN=CAPG PE=1 SV=2 52 385 4.0E-38
sp|Q865V6|CAPG_BOVIN Macrophage-capping protein OS=Bos taurus GN=CAPG PE=2 SV=1 49 385 4.0E-37
sp|O15195|VILL_HUMAN Villin-like protein OS=Homo sapiens GN=VILL PE=2 SV=3 43 385 5.0E-32
sp|Q91YD6|VILL_MOUSE Villin-like protein OS=Mus musculus GN=Vill PE=1 SV=1 46 385 6.0E-29
sp|O93510|GELS_CHICK Gelsolin OS=Gallus gallus GN=GSN PE=2 SV=1 54 385 7.0E-28
sp|O75366|AVIL_HUMAN Advillin OS=Homo sapiens GN=AVIL PE=1 SV=3 31 385 8.0E-28
sp|P14885|GELS_XENLA Gelsolin (Fragment) OS=Xenopus laevis GN=gsn PE=2 SV=1 54 385 1.0E-25
sp|O81643|VILI1_ARATH Villin-1 OS=Arabidopsis thaliana GN=VLN1 PE=2 SV=2 47 385 2.0E-25
sp|P20305|GELS_PIG Gelsolin (Fragment) OS=Sus scrofa GN=GSN PE=1 SV=1 18 385 2.0E-25
sp|O88398|AVIL_MOUSE Advillin OS=Mus musculus GN=Avil PE=1 SV=2 31 385 4.0E-25
sp|P06396|GELS_HUMAN Gelsolin OS=Homo sapiens GN=GSN PE=1 SV=1 18 385 4.0E-25
sp|Q3SX14|GELS_BOVIN Gelsolin OS=Bos taurus GN=GSN PE=2 SV=1 18 385 7.0E-25
sp|P34268|FLII_CAEEL Protein flightless-1 homolog OS=Caenorhabditis elegans GN=fli-1 PE=2 SV=2 44 347 8.0E-25
sp|P13020|GELS_MOUSE Gelsolin OS=Mus musculus GN=Gsn PE=1 SV=3 18 385 8.0E-25
sp|Q24020|FLII_DROME Protein flightless-1 OS=Drosophila melanogaster GN=fliI PE=2 SV=1 48 385 9.0E-25
sp|Q13045|FLII_HUMAN Protein flightless-1 homolog OS=Homo sapiens GN=FLII PE=1 SV=2 47 385 5.0E-24
sp|Q28372|GELS_HORSE Gelsolin OS=Equus caballus GN=GSN PE=1 SV=2 50 385 7.0E-24
sp|Q68FP1|GELS_RAT Gelsolin OS=Rattus norvegicus GN=Gsn PE=1 SV=1 18 385 7.0E-24
sp|Q9JJ28|FLII_MOUSE Protein flightless-1 homolog OS=Mus musculus GN=Flii PE=1 SV=1 30 385 1.0E-23
sp|Q27319|GELS_HOMAM Gelsolin, cytoplasmic OS=Homarus americanus PE=1 SV=1 58 385 2.0E-23
sp|P02640|VILI_CHICK Villin-1 OS=Gallus gallus GN=VIL1 PE=1 SV=2 31 385 3.0E-23
sp|Q9WU06|AVIL_RAT Advillin OS=Rattus norvegicus GN=Avil PE=2 SV=1 31 385 9.0E-23
sp|P09327|VILI_HUMAN Villin-1 OS=Homo sapiens GN=VIL1 PE=1 SV=4 31 385 2.0E-22
sp|Q29261|VILI_PIG Villin-1 OS=Sus scrofa GN=VIL1 PE=2 SV=2 31 385 5.0E-21
sp|Q3SZP7|VILI_BOVIN Villin-1 OS=Bos taurus GN=VIL1 PE=2 SV=3 18 385 1.0E-20
sp|Q8WQ85|VILD_DICDI Villidin OS=Dictyostelium discoideum GN=vilA PE=1 SV=2 25 347 5.0E-20
sp|Q62468|VILI_MOUSE Villin-1 OS=Mus musculus GN=Vil1 PE=1 SV=3 18 385 1.0E-19
sp|Q28046|ADSV_BOVIN Adseverin OS=Bos taurus GN=SCIN PE=1 SV=1 53 385 1.0E-18
sp|Q9Y6U3|ADSV_HUMAN Adseverin OS=Homo sapiens GN=SCIN PE=1 SV=4 53 385 1.0E-18
sp|Q60604|ADSV_MOUSE Adseverin OS=Mus musculus GN=Scin PE=1 SV=3 50 385 1.0E-17
sp|Q5ZIV9|ADSV_CHICK Adseverin OS=Gallus gallus GN=SCIN PE=2 SV=2 53 385 3.0E-15
sp|O81644|VILI2_ARATH Villin-2 OS=Arabidopsis thaliana GN=VLN2 PE=1 SV=2 53 385 5.0E-15
sp|O81645|VILI3_ARATH Villin-3 OS=Arabidopsis thaliana GN=VLN3 PE=1 SV=2 53 385 9.0E-15
sp|O15195|VILL_HUMAN Villin-like protein OS=Homo sapiens GN=VILL PE=2 SV=3 53 385 6.0E-14
sp|P36418|VILB_DICDI Protovillin OS=Dictyostelium discoideum GN=vilB PE=1 SV=1 1 385 9.0E-13
sp|O65570|VILI4_ARATH Villin-4 OS=Arabidopsis thaliana GN=VLN4 PE=1 SV=1 47 383 8.0E-10
sp|Q29297|ADSV_PIG Adseverin (Fragment) OS=Sus scrofa GN=SCIN PE=2 SV=1 132 235 2.0E-09
sp|Q9LVC6|VILI5_ARATH Villin-5 OS=Arabidopsis thaliana GN=VLN5 PE=2 SV=1 24 387 5.0E-09
sp|Q91YD6|VILL_MOUSE Villin-like protein OS=Mus musculus GN=Vill PE=1 SV=1 53 385 2.0E-08
sp|Q8K4L3|SVIL_MOUSE Supervillin OS=Mus musculus GN=Svil PE=1 SV=1 50 148 2.0E-07
sp|O95425|SVIL_HUMAN Supervillin OS=Homo sapiens GN=SVIL PE=1 SV=2 50 148 2.0E-07
sp|O46385|SVIL_BOVIN Supervillin OS=Bos taurus GN=SVIL PE=1 SV=2 52 148 2.0E-06
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5363
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3984 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|4768
Ophiocordyceps camponoti-floridani Ophcf2|05936
Ophiocordyceps camponoti-rufipedis Ophun1|4498
Ophiocordyceps subramaniannii Hirsu2|5278

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|3984
MPPHEGLVHPKEYDIKDSNVELIGADIDHRVKYKSAATEPAWNDGAVGKTAGLKIWRIENFEVVPWPKQRHGQFY
DGDSFIVLHSYKVGKDSDKLGHDIFFWLGAHTTQDEAGTAAYKTVELDEFLNGAATQHREVQQAPSDAFLALFPR
IKISAGGVASGFRHVERDGEQVQGQQNVLLRVFTPVGSSVVAHEVEPSWRSLDDGDVFVLDTGDKMWLWQGMRSS
PMEKARAAALVHDLTLESKKRIDVEVVAQSESRSRRVIDLLGGDQETPREGFRQPRPLGSGPKEEARSKKQLFRL
SDASGQLEFVLVCEGARVPRGQLDGNDVFVLDDGGRAVWVWEGRGASVAERAKWLGVARAYMARVGGEQLVPLAK
VKEGSEGGAFWKALEVQ*
Coding >OphauG2|3984
ATGCCACCACACGAAGGCCTAGTCCACCCCAAAGAATACGACATCAAGGACAGCAACGTCGAGCTGATTGGGGCC
GATATTGACCACCGCGTCAAGTACAAGTCGGCAGCAACTGAGCCTGCGTGGAACGATGGCGCCGTTGGCAAGACT
GCGGGCTTGAAGATTTGGCGCATCGAGAATTTCGAGGTGGTGCCATGGCCAAAGCAACGCCATGGGCAATTCTAT
GACGGCGATAGCTTCATTGTTCTACACTCGTACAAGGTGGGCAAGGACTCGGACAAGCTTGGGCACGACATCTTT
TTCTGGCTGGGCGCGCACACGACGCAAGACGAGGCTGGCACGGCGGCGTACAAAACGGTTGAGCTCGACGAGTTT
CTCAACGGAGCGGCCACGCAGCATCGCGAAGTGCAGCAGGCGCCGTCGGATGCCTTTCTTGCCCTCTTCCCGCGC
ATCAAGATTAGTGCAGGCGGGGTTGCATCTGGCTTCCGACATGTCGAGCGCGACGGAGAACAAGTGCAAGGGCAG
CAAAACGTGCTGCTACGCGTCTTTACTCCCGTGGGCAGCAGTGTTGTGGCTCACGAGGTAGAGCCGTCGTGGCGC
AGTCTGGATGACGGAGACGTCTTTGTGCTGGACACAGGTGACAAGATGTGGCTATGGCAAGGGATGCGTAGCAGT
CCCATGGAAAAAGCACGCGCCGCAGCGCTGGTGCACGACTTGACGCTTGAGAGCAAGAAGCGCATCGACGTGGAA
GTTGTTGCGCAGAGCGAATCGCGTTCTCGACGTGTCATTGACTTGTTGGGCGGAGACCAAGAGACGCCCCGCGAG
GGATTCCGACAGCCACGACCGCTGGGCAGCGGGCCCAAGGAGGAAGCAAGAAGCAAGAAGCAGCTGTTCCGACTG
AGCGATGCGTCGGGCCAGCTCGAGTTTGTGCTGGTGTGTGAGGGAGCGAGAGTGCCGCGGGGGCAACTGGATGGT
AATGATGTCTTTGTCCTGGACGATGGGGGCAGGGCGGTGTGGGTTTGGGAGGGACGGGGGGCGAGTGTGGCAGAG
AGGGCAAAGTGGTTGGGTGTTGCGAGGGCGTATATGGCGAGAGTTGGAGGGGAGCAGCTGGTGCCGTTGGCAAAG
GTGAAGGAGGGAAGTGAAGGAGGAGCGTTTTGGAAAGCGTTGGAGGTGCAGTAG
Transcript >OphauG2|3984
ATGCCACCACACGAAGGCCTAGTCCACCCCAAAGAATACGACATCAAGGACAGCAACGTCGAGCTGATTGGGGCC
GATATTGACCACCGCGTCAAGTACAAGTCGGCAGCAACTGAGCCTGCGTGGAACGATGGCGCCGTTGGCAAGACT
GCGGGCTTGAAGATTTGGCGCATCGAGAATTTCGAGGTGGTGCCATGGCCAAAGCAACGCCATGGGCAATTCTAT
GACGGCGATAGCTTCATTGTTCTACACTCGTACAAGGTGGGCAAGGACTCGGACAAGCTTGGGCACGACATCTTT
TTCTGGCTGGGCGCGCACACGACGCAAGACGAGGCTGGCACGGCGGCGTACAAAACGGTTGAGCTCGACGAGTTT
CTCAACGGAGCGGCCACGCAGCATCGCGAAGTGCAGCAGGCGCCGTCGGATGCCTTTCTTGCCCTCTTCCCGCGC
ATCAAGATTAGTGCAGGCGGGGTTGCATCTGGCTTCCGACATGTCGAGCGCGACGGAGAACAAGTGCAAGGGCAG
CAAAACGTGCTGCTACGCGTCTTTACTCCCGTGGGCAGCAGTGTTGTGGCTCACGAGGTAGAGCCGTCGTGGCGC
AGTCTGGATGACGGAGACGTCTTTGTGCTGGACACAGGTGACAAGATGTGGCTATGGCAAGGGATGCGTAGCAGT
CCCATGGAAAAAGCACGCGCCGCAGCGCTGGTGCACGACTTGACGCTTGAGAGCAAGAAGCGCATCGACGTGGAA
GTTGTTGCGCAGAGCGAATCGCGTTCTCGACGTGTCATTGACTTGTTGGGCGGAGACCAAGAGACGCCCCGCGAG
GGATTCCGACAGCCACGACCGCTGGGCAGCGGGCCCAAGGAGGAAGCAAGAAGCAAGAAGCAGCTGTTCCGACTG
AGCGATGCGTCGGGCCAGCTCGAGTTTGTGCTGGTGTGTGAGGGAGCGAGAGTGCCGCGGGGGCAACTGGATGGT
AATGATGTCTTTGTCCTGGACGATGGGGGCAGGGCGGTGTGGGTTTGGGAGGGACGGGGGGCGAGTGTGGCAGAG
AGGGCAAAGTGGTTGGGTGTTGCGAGGGCGTATATGGCGAGAGTTGGAGGGGAGCAGCTGGTGCCGTTGGCAAAG
GTGAAGGAGGGAAGTGAAGGAGGAGCGTTTTGGAAAGCGTTGGAGGTGCAGTAG
Gene >OphauG2|3984
ATGCCACCACACGAAGGCCTAGTCCACCCCAAAGAATACGACATCAAGGACAGCAACGTCGAGCTGATTGGGGCC
GATATTGACCACCGCGTCAAGTACAAGTCGGCAGCAACTGAGCCTGCGTGGAACGATGGCGCCGTTGGCAAGACT
GCGGGCTTGAAGATTTGGCGCATCGAGAATTTCGAGGTGGTGCCATGGCCAAAGCAACGCCATGGGCAATTCTAT
GACGGCGATAGCTTCATTGTTCTACACTCGTACAAGGTGGGCAAGGACTCGGACAAGCTTGGGCACGACATCTTT
TTCTGGCTGGGCGCGCACACGACGCAAGACGAGGCTGGCACGGCGGCGTACAAAACGGTTGAGCTCGACGAGTTT
CTCAACGGAGCGGCCACGCAGCATCGCGAAGTGCAGCAGGCGCCGTCGGATGCCTTTCTTGCCCTCTTCCCGCGC
ATCAAGATTAGTGCAGGCGGGGTTGCATCTGGCTTCCGACATGTCGAGCGCGACGGAGAACAAGTGCAAGGGCAG
CAAAACGTGCTGCTACGCGTCTTTACTCCCGTGGGCAGCAGTGTTGTGGCTCACGAGGTAGAGCCGTCGTGGCGC
AGTCTGGATGACGGAGACGTCTTTGTGCTGGACACAGGTGACAAGATGTGGCTATGGCAAGGGATGCGTAGCAGT
CCCATGGAAAAAGCACGCGCCGCAGCGCTGGTGCACGACTTGACGCTTGAGAGCAAGAAGCGCATCGACGTGGAA
GTTGTTGCGCAGAGCGAATCGCGTTCTCGACGTGTCATTGACTTGTTGGGCGGAGACCAAGAGACGCCCCGCGAG
GGATTCCGACAGCCACGACCGCTGGGCAGCGGGCCCAAGGAGGAAGCAAGAAGCAAGAAGCAGCTGTTCCGACTG
AGCGATGCGTCGGGCCAGCTCGAGTTTGTGCTGGTGTGTGAGGGAGCGAGAGTGCCGCGGGGGCAACTGGATGGT
AATGATGTCTTTGTCCTGGACGATGGGGGCAGGGCGGTGTGGGTTTGGGAGGGACGGGGGGCGAGTGTGGCAGAG
AGGGCAAAGTGGTTGGGTGTTGCGAGGGCGTATATGGCGAGAGTTGGAGGGGAGCAGCTGGTGCCGTTGGCAAAG
GTGAAGGAGGGAAGTGAAGGAGGAGCGTTTTGGAAAGCGTTGGAGGTGCAGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail