Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|3979
Gene name
LocationContig_315:15302..18929
Strand-
Gene length (bp)3627
Transcript length (bp)3504
Coding sequence length (bp)3504
Protein length (aa) 1168

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10433 MMS1_N Mono-functional DNA-alkylating methyl methanesulfonate N-term 1.0E-109 73 592
PF03178 CPSF_A CPSF A subunit region 1.6E-54 805 1136

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q6QNU4|DDB1_SOLLC DNA damage-binding protein 1 OS=Solanum lycopersicum GN=DDB1 PE=1 SV=1 2 1167 1.0E-118
sp|Q6E7D1|DDB1_SOLCE DNA damage-binding protein 1 OS=Solanum cheesmaniae GN=DDB1 PE=3 SV=1 2 1167 4.0E-118
sp|Q9M0V3|DDB1A_ARATH DNA damage-binding protein 1a OS=Arabidopsis thaliana GN=DDB1A PE=1 SV=1 2 1167 1.0E-116
sp|O49552|DDB1B_ARATH DNA damage-binding protein 1b OS=Arabidopsis thaliana GN=DDB1B PE=2 SV=2 2 1167 3.0E-114
sp|Q3U1J4|DDB1_MOUSE DNA damage-binding protein 1 OS=Mus musculus GN=Ddb1 PE=1 SV=2 2 1167 1.0E-106
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q6QNU4|DDB1_SOLLC DNA damage-binding protein 1 OS=Solanum lycopersicum GN=DDB1 PE=1 SV=1 2 1167 1.0E-118
sp|Q6E7D1|DDB1_SOLCE DNA damage-binding protein 1 OS=Solanum cheesmaniae GN=DDB1 PE=3 SV=1 2 1167 4.0E-118
sp|Q9M0V3|DDB1A_ARATH DNA damage-binding protein 1a OS=Arabidopsis thaliana GN=DDB1A PE=1 SV=1 2 1167 1.0E-116
sp|O49552|DDB1B_ARATH DNA damage-binding protein 1b OS=Arabidopsis thaliana GN=DDB1B PE=2 SV=2 2 1167 3.0E-114
sp|Q3U1J4|DDB1_MOUSE DNA damage-binding protein 1 OS=Mus musculus GN=Ddb1 PE=1 SV=2 2 1167 1.0E-106
sp|Q805F9|DDB1_CHICK DNA damage-binding protein 1 OS=Gallus gallus GN=DDB1 PE=1 SV=1 2 1167 1.0E-105
sp|A1A4K3|DDB1_BOVIN DNA damage-binding protein 1 OS=Bos taurus GN=DDB1 PE=1 SV=1 2 1167 2.0E-105
sp|P33194|DDB1_CHLAE DNA damage-binding protein 1 OS=Chlorocebus aethiops GN=DDB1 PE=1 SV=1 2 1167 2.0E-105
sp|Q16531|DDB1_HUMAN DNA damage-binding protein 1 OS=Homo sapiens GN=DDB1 PE=1 SV=1 2 1167 6.0E-105
sp|Q5R649|DDB1_PONAB DNA damage-binding protein 1 OS=Pongo abelii GN=DDB1 PE=2 SV=1 2 1167 1.0E-104
sp|Q6P6Z0|DDB1_XENLA DNA damage-binding protein 1 OS=Xenopus laevis GN=ddb1 PE=2 SV=1 2 1167 2.0E-102
sp|Q9ESW0|DDB1_RAT DNA damage-binding protein 1 OS=Rattus norvegicus GN=Ddb1 PE=1 SV=1 2 1167 3.0E-101
sp|Q9XYZ5|DDB1_DROME DNA damage-binding protein 1 OS=Drosophila melanogaster GN=pic PE=1 SV=1 3 1167 2.0E-89
sp|O13807|DDB1_SCHPO DNA damage-binding protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ddb1 PE=1 SV=1 1 1167 2.0E-80
sp|B0M0P5|DDB1_DICDI DNA damage-binding protein 1 OS=Dictyostelium discoideum GN=repE PE=1 SV=1 2 1164 3.0E-72
sp|Q21554|DDB1_CAEEL DNA damage-binding protein 1 OS=Caenorhabditis elegans GN=ddb-1 PE=1 SV=2 1 1167 7.0E-45
sp|Q4WLI5|RSE1_ASPFU Pre-mRNA-splicing factor rse1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=rse1 PE=3 SV=1 3 1021 3.0E-09
[Show less]

GO

GO Term Description Terminal node
GO:0005634 nucleus Yes
GO:0003676 nucleic acid binding Yes
GO:0003674 molecular_function No
GO:0043229 intracellular organelle No
GO:0043231 intracellular membrane-bounded organelle No
GO:1901363 heterocyclic compound binding No
GO:0043227 membrane-bounded organelle No
GO:0043226 organelle No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No
GO:0005575 cellular_component No
GO:0110165 cellular anatomical entity No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4231
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3979 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|4646
Ophiocordyceps camponoti-floridani Ophcf2|02871
Ophiocordyceps camponoti-rufipedis Ophun1|5632
Ophiocordyceps kimflemingae Ophio5|1082
Ophiocordyceps subramaniannii Hirsu2|8637

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|3979
MSYFAPVHRPTSIRHALSIRLLSPDHQDLVLAKTNRLEVWRVSATGMTCLHSKVIFGTIIMLQRLQPKDSPTDLL
FVGTDRQQYFNISWNPQISQLEMVWGPIHDTAEPYMRPSQSQNKCLVDPTGMFMAMHLWEGVINVFRLPTRKGQT
KNIQVLDQVRITELWMKSSIFLHSRTGHPRIAFLYKTQLDHEEARIAIYRLTRDDKGDDVSRFDSQKERELDHVI
CDPYASILIPVPVVEEKRYHVRNNKGARPHLGGVLVVGETVLTYFDSLTYMSVTETLPEPKLYVAWAEYDGICYF
LADDYGCIDLLTIETVHELTGVVITGMSVTRMRLADPMSHISRASNLVYMGNDMLFLASHHGDSQLLRVNVVEQT
LTVVQTLSNNAPILDFTIMDMGNRQADTQVTSAFSSGQARIVAGCGAYNDGSLRSIRSGVGLHDDGVLDDIVGTR
GLFALRSSGAAKVDMLVVSSVAETRILRFDASGGIEEIFEFHGMALDRETLLAANLDDGTLLQVTPHSVRVLSMA
SDMEVCAWKPPQGKSITTASCNGQWALVAVEGTTLVSLNLLDNLAAASKDAKPNSTSGDKDQISCLHAARSPSGL
GVVGWWSAGTISIVDLATLEPLHGESLRKTEDSASIARDIALVQLHPPSTGESTLLVAMEDGSVVTFQVTLKEFF
ISGRKSVTLGSSPARLHILPQDDGTCNVFATTEHASLIYSSEGRIVFSATSANDATYVVPFDSVAFPKSVIMATD
SHLQLCRIDKERLTHVKALPLRETVRRVAYSPGLKAFGLGCIKKELVDSDEVITSSFKLVDEVVFQQLGKPFMLD
ASATLEMVESVIRAELPDSGGVPTERFIVGTSFLTDEEMVEDGDVRGRILVLGVDSDRQVYQVLSHKLKGSCRCL
GVMGNYVVAGLSKTVVVYSYSQETTASGSLHKMAAYRTSSYPIDLDIAGNMIGIVDLMQSLCLVEFVPPHDGAQA
ELVERGRHHEPTWATSVCYLDGGRWLEADAQGNLMVLRRNEEAPAERERCRLEVTSDINVGEQINRIRRLQAVQQ
ENAIVTPKAFLASVEGALYLFGEISPEYQDLLITFQERLSACFCLLGDEESGKVRFEEWRAFRGQTRTGEGPYRF
IDGEMLERFLDLSEREQKSVCEGLGPSMEHLRSMVEELRLMH*
Coding >OphauG2|3979
ATGTCTTATTTTGCGCCAGTTCACCGGCCTACCAGCATTCGGCATGCTCTGAGCATTCGTCTACTCTCTCCAGAC
CACCAAGACCTGGTCTTGGCCAAGACCAACCGGCTCGAGGTATGGCGCGTTTCCGCCACTGGCATGACTTGTCTG
CATTCAAAGGTCATCTTTGGAACCATAATCATGCTGCAGCGGCTGCAGCCCAAGGACTCGCCCACCGACCTGCTC
TTTGTAGGCACCGATAGGCAGCAGTATTTCAACATATCGTGGAACCCCCAAATCAGCCAGCTCGAGATGGTTTGG
GGGCCAATTCATGACACTGCTGAGCCATATATGCGTCCTTCTCAGAGCCAAAACAAGTGCCTGGTAGACCCCACG
GGCATGTTTATGGCTATGCATCTTTGGGAGGGCGTCATCAACGTCTTTCGCCTGCCCACCCGCAAGGGCCAGACC
AAGAACATCCAGGTACTCGACCAAGTTCGAATTACCGAGTTGTGGATGAAATCCAGCATTTTCCTTCATAGTCGG
ACCGGCCATCCACGCATAGCCTTTCTTTACAAGACACAGCTCGACCACGAAGAGGCGCGCATTGCCATTTACAGA
CTGACAAGGGACGACAAGGGGGATGATGTCTCCCGCTTCGATTCACAAAAGGAAAGAGAGCTTGACCATGTTATC
TGCGATCCATATGCATCGATACTTATCCCAGTCCCCGTGGTCGAAGAGAAGCGTTACCATGTGCGGAACAACAAG
GGCGCCAGGCCTCACCTGGGTGGTGTCCTGGTGGTGGGAGAGACGGTACTGACCTACTTTGACAGTCTCACATAT
ATGAGTGTCACTGAAACTCTCCCAGAGCCCAAGTTGTACGTGGCCTGGGCTGAATACGACGGCATATGCTACTTC
CTGGCCGATGACTACGGCTGTATAGATCTCTTGACTATAGAAACAGTCCACGAGCTTACAGGCGTTGTAATCACG
GGCATGAGCGTGACTCGAATGCGCCTTGCGGATCCCATGTCGCACATTTCGCGAGCGTCAAATCTTGTGTACATG
GGAAACGACATGTTGTTTCTGGCCTCACACCATGGTGATTCGCAGCTGCTACGGGTCAATGTTGTGGAACAAACA
TTGACAGTAGTTCAAACCCTGTCAAACAATGCGCCCATTCTCGACTTTACCATTATGGACATGGGAAACCGTCAA
GCTGACACCCAAGTCACCAGCGCTTTTTCCTCGGGACAGGCAAGAATTGTGGCGGGCTGTGGCGCCTACAATGAC
GGGAGCCTGCGCAGTATTCGCAGCGGTGTCGGCCTTCACGACGATGGCGTTCTCGATGACATTGTGGGAACCCGC
GGACTGTTTGCCCTGCGCTCGTCTGGTGCGGCCAAGGTGGACATGCTCGTCGTATCGTCTGTAGCTGAGACTAGG
ATTCTCCGGTTTGACGCCAGTGGAGGCATCGAAGAGATTTTCGAATTTCATGGCATGGCTTTGGACCGAGAGACG
CTGCTGGCAGCCAACCTTGACGACGGAACCCTGCTCCAAGTGACGCCGCACTCGGTTAGAGTGCTGAGCATGGCC
AGCGACATGGAGGTGTGTGCTTGGAAACCTCCACAGGGAAAATCCATCACCACTGCGTCCTGCAATGGCCAGTGG
GCTCTGGTGGCCGTGGAGGGAACGACTTTGGTGTCACTCAACTTGCTCGACAACCTGGCCGCAGCATCCAAGGAT
GCGAAGCCAAACTCGACGTCGGGCGACAAAGACCAGATATCCTGCTTACATGCAGCCAGGAGTCCTTCGGGTCTG
GGCGTGGTGGGCTGGTGGTCTGCTGGAACAATATCCATTGTCGACCTGGCCACCCTGGAGCCGCTTCACGGCGAG
TCTTTGCGGAAAACAGAGGATAGCGCCTCTATTGCGCGAGACATTGCCCTCGTACAGCTCCATCCGCCAAGCACA
GGCGAATCGACGTTACTCGTCGCAATGGAGGACGGCAGCGTGGTAACCTTTCAGGTGACACTCAAGGAATTCTTT
ATATCTGGCCGCAAAAGTGTTACCCTGGGCAGCAGCCCTGCCAGGCTGCACATTCTGCCTCAGGATGACGGCACT
TGCAACGTTTTTGCCACGACTGAGCATGCCAGCCTGATTTACAGTAGCGAGGGTCGCATTGTCTTTTCGGCCACG
TCTGCAAATGATGCCACGTACGTGGTTCCTTTTGACTCGGTGGCTTTCCCCAAGTCGGTCATCATGGCGACAGAT
TCTCACTTGCAGCTGTGTCGCATCGACAAGGAGCGTCTCACGCACGTCAAGGCATTGCCGCTACGTGAAACAGTG
CGCCGCGTTGCTTACTCGCCCGGACTCAAGGCCTTTGGTTTGGGGTGCATAAAAAAGGAACTGGTGGATAGTGAC
GAGGTAATCACAAGCTCCTTCAAGCTGGTGGATGAAGTTGTATTCCAGCAATTGGGGAAGCCTTTCATGCTCGAT
GCATCGGCCACGCTTGAAATGGTGGAGAGTGTCATCCGCGCCGAACTGCCAGATAGCGGTGGTGTGCCTACAGAG
CGCTTTATTGTGGGAACCAGCTTCCTCACGGACGAGGAAATGGTAGAGGATGGAGACGTGCGCGGGCGCATCTTG
GTTCTTGGAGTCGACTCTGACCGACAGGTGTATCAAGTGCTTTCGCATAAACTCAAGGGATCGTGCCGCTGCCTG
GGAGTCATGGGCAACTACGTTGTGGCTGGTCTCTCCAAGACAGTTGTGGTTTACAGTTATAGCCAAGAGACGACG
GCATCCGGATCCTTGCATAAAATGGCGGCATACCGGACGTCGTCGTACCCCATTGACTTGGACATAGCGGGCAAC
ATGATTGGCATCGTTGATCTCATGCAGTCACTCTGTCTCGTTGAGTTTGTGCCTCCACACGACGGGGCTCAAGCA
GAATTAGTAGAGCGAGGCCGGCATCATGAACCGACTTGGGCAACTTCGGTGTGCTACTTGGATGGAGGAAGATGG
CTAGAGGCCGACGCCCAAGGCAACCTAATGGTTTTGAGGAGAAACGAGGAGGCACCGGCGGAGCGAGAAAGATGT
CGACTCGAAGTGACGAGTGACATCAATGTTGGAGAGCAAATTAATCGAATACGGAGGCTGCAGGCAGTTCAGCAG
GAAAATGCCATTGTGACTCCCAAAGCCTTTCTGGCATCGGTTGAGGGCGCGCTGTACCTCTTTGGAGAAATATCT
CCCGAATACCAAGACCTTCTCATTACATTTCAAGAGAGATTGTCGGCTTGTTTCTGCCTGCTAGGAGATGAGGAA
TCGGGAAAAGTAAGATTTGAAGAGTGGCGAGCCTTTCGCGGCCAGACACGGACCGGCGAGGGGCCGTATAGGTTT
ATTGACGGGGAAATGCTGGAGAGGTTTTTGGATCTCAGCGAAAGGGAGCAGAAGAGCGTGTGTGAAGGATTAGGG
CCGAGCATGGAGCATCTGCGGAGCATGGTGGAAGAACTAAGACTAATGCACTAG
Transcript >OphauG2|3979
ATGTCTTATTTTGCGCCAGTTCACCGGCCTACCAGCATTCGGCATGCTCTGAGCATTCGTCTACTCTCTCCAGAC
CACCAAGACCTGGTCTTGGCCAAGACCAACCGGCTCGAGGTATGGCGCGTTTCCGCCACTGGCATGACTTGTCTG
CATTCAAAGGTCATCTTTGGAACCATAATCATGCTGCAGCGGCTGCAGCCCAAGGACTCGCCCACCGACCTGCTC
TTTGTAGGCACCGATAGGCAGCAGTATTTCAACATATCGTGGAACCCCCAAATCAGCCAGCTCGAGATGGTTTGG
GGGCCAATTCATGACACTGCTGAGCCATATATGCGTCCTTCTCAGAGCCAAAACAAGTGCCTGGTAGACCCCACG
GGCATGTTTATGGCTATGCATCTTTGGGAGGGCGTCATCAACGTCTTTCGCCTGCCCACCCGCAAGGGCCAGACC
AAGAACATCCAGGTACTCGACCAAGTTCGAATTACCGAGTTGTGGATGAAATCCAGCATTTTCCTTCATAGTCGG
ACCGGCCATCCACGCATAGCCTTTCTTTACAAGACACAGCTCGACCACGAAGAGGCGCGCATTGCCATTTACAGA
CTGACAAGGGACGACAAGGGGGATGATGTCTCCCGCTTCGATTCACAAAAGGAAAGAGAGCTTGACCATGTTATC
TGCGATCCATATGCATCGATACTTATCCCAGTCCCCGTGGTCGAAGAGAAGCGTTACCATGTGCGGAACAACAAG
GGCGCCAGGCCTCACCTGGGTGGTGTCCTGGTGGTGGGAGAGACGGTACTGACCTACTTTGACAGTCTCACATAT
ATGAGTGTCACTGAAACTCTCCCAGAGCCCAAGTTGTACGTGGCCTGGGCTGAATACGACGGCATATGCTACTTC
CTGGCCGATGACTACGGCTGTATAGATCTCTTGACTATAGAAACAGTCCACGAGCTTACAGGCGTTGTAATCACG
GGCATGAGCGTGACTCGAATGCGCCTTGCGGATCCCATGTCGCACATTTCGCGAGCGTCAAATCTTGTGTACATG
GGAAACGACATGTTGTTTCTGGCCTCACACCATGGTGATTCGCAGCTGCTACGGGTCAATGTTGTGGAACAAACA
TTGACAGTAGTTCAAACCCTGTCAAACAATGCGCCCATTCTCGACTTTACCATTATGGACATGGGAAACCGTCAA
GCTGACACCCAAGTCACCAGCGCTTTTTCCTCGGGACAGGCAAGAATTGTGGCGGGCTGTGGCGCCTACAATGAC
GGGAGCCTGCGCAGTATTCGCAGCGGTGTCGGCCTTCACGACGATGGCGTTCTCGATGACATTGTGGGAACCCGC
GGACTGTTTGCCCTGCGCTCGTCTGGTGCGGCCAAGGTGGACATGCTCGTCGTATCGTCTGTAGCTGAGACTAGG
ATTCTCCGGTTTGACGCCAGTGGAGGCATCGAAGAGATTTTCGAATTTCATGGCATGGCTTTGGACCGAGAGACG
CTGCTGGCAGCCAACCTTGACGACGGAACCCTGCTCCAAGTGACGCCGCACTCGGTTAGAGTGCTGAGCATGGCC
AGCGACATGGAGGTGTGTGCTTGGAAACCTCCACAGGGAAAATCCATCACCACTGCGTCCTGCAATGGCCAGTGG
GCTCTGGTGGCCGTGGAGGGAACGACTTTGGTGTCACTCAACTTGCTCGACAACCTGGCCGCAGCATCCAAGGAT
GCGAAGCCAAACTCGACGTCGGGCGACAAAGACCAGATATCCTGCTTACATGCAGCCAGGAGTCCTTCGGGTCTG
GGCGTGGTGGGCTGGTGGTCTGCTGGAACAATATCCATTGTCGACCTGGCCACCCTGGAGCCGCTTCACGGCGAG
TCTTTGCGGAAAACAGAGGATAGCGCCTCTATTGCGCGAGACATTGCCCTCGTACAGCTCCATCCGCCAAGCACA
GGCGAATCGACGTTACTCGTCGCAATGGAGGACGGCAGCGTGGTAACCTTTCAGGTGACACTCAAGGAATTCTTT
ATATCTGGCCGCAAAAGTGTTACCCTGGGCAGCAGCCCTGCCAGGCTGCACATTCTGCCTCAGGATGACGGCACT
TGCAACGTTTTTGCCACGACTGAGCATGCCAGCCTGATTTACAGTAGCGAGGGTCGCATTGTCTTTTCGGCCACG
TCTGCAAATGATGCCACGTACGTGGTTCCTTTTGACTCGGTGGCTTTCCCCAAGTCGGTCATCATGGCGACAGAT
TCTCACTTGCAGCTGTGTCGCATCGACAAGGAGCGTCTCACGCACGTCAAGGCATTGCCGCTACGTGAAACAGTG
CGCCGCGTTGCTTACTCGCCCGGACTCAAGGCCTTTGGTTTGGGGTGCATAAAAAAGGAACTGGTGGATAGTGAC
GAGGTAATCACAAGCTCCTTCAAGCTGGTGGATGAAGTTGTATTCCAGCAATTGGGGAAGCCTTTCATGCTCGAT
GCATCGGCCACGCTTGAAATGGTGGAGAGTGTCATCCGCGCCGAACTGCCAGATAGCGGTGGTGTGCCTACAGAG
CGCTTTATTGTGGGAACCAGCTTCCTCACGGACGAGGAAATGGTAGAGGATGGAGACGTGCGCGGGCGCATCTTG
GTTCTTGGAGTCGACTCTGACCGACAGGTGTATCAAGTGCTTTCGCATAAACTCAAGGGATCGTGCCGCTGCCTG
GGAGTCATGGGCAACTACGTTGTGGCTGGTCTCTCCAAGACAGTTGTGGTTTACAGTTATAGCCAAGAGACGACG
GCATCCGGATCCTTGCATAAAATGGCGGCATACCGGACGTCGTCGTACCCCATTGACTTGGACATAGCGGGCAAC
ATGATTGGCATCGTTGATCTCATGCAGTCACTCTGTCTCGTTGAGTTTGTGCCTCCACACGACGGGGCTCAAGCA
GAATTAGTAGAGCGAGGCCGGCATCATGAACCGACTTGGGCAACTTCGGTGTGCTACTTGGATGGAGGAAGATGG
CTAGAGGCCGACGCCCAAGGCAACCTAATGGTTTTGAGGAGAAACGAGGAGGCACCGGCGGAGCGAGAAAGATGT
CGACTCGAAGTGACGAGTGACATCAATGTTGGAGAGCAAATTAATCGAATACGGAGGCTGCAGGCAGTTCAGCAG
GAAAATGCCATTGTGACTCCCAAAGCCTTTCTGGCATCGGTTGAGGGCGCGCTGTACCTCTTTGGAGAAATATCT
CCCGAATACCAAGACCTTCTCATTACATTTCAAGAGAGATTGTCGGCTTGTTTCTGCCTGCTAGGAGATGAGGAA
TCGGGAAAAGTAAGATTTGAAGAGTGGCGAGCCTTTCGCGGCCAGACACGGACCGGCGAGGGGCCGTATAGGTTT
ATTGACGGGGAAATGCTGGAGAGGTTTTTGGATCTCAGCGAAAGGGAGCAGAAGAGCGTGTGTGAAGGATTAGGG
CCGAGCATGGAGCATCTGCGGAGCATGGTGGAAGAACTAAGACTAATGCACTAG
Gene >OphauG2|3979
ATGTCTTATTTTGCGCCAGTTCACCGGCCTACCAGCATTCGGCATGCTCTGAGCATTCGTCTACTCTCTCCAGAC
CACCAAGACCTGGTCTTGGCGTGAGTTGCTTCTACCTGCACTCGAGCTAGAGGAACAAGCTTGCTGACTAGAGGC
GCGTACAGCAAGACCAACCGGCTCGAGGTATGGCGCGTTTCCGCCACTGGCATGACTTGTCTGCATTCAAAGGTC
ATCTTTGGAACCATAATCATGCTGCAGCGGCTGCAGCCCAAGGACTCGCCCACCGACCTGCTCTTTGTAGGCACC
GATAGGCAGCAGTATTTCAACATATCGTGGAACCCCCAAATCAGCCAGCTCGAGATGGTTTGGGGGCCAATTCAT
GACACTGCTGAGCCATATATGCGTCCTTCTCAGAGCCAAAACAAGTGCCTGGTAGACCCCACGGGCATGTTTATG
GCTATGCATCTTTGGGAGGGCGTCATCAACGTCTTTCGCCTGCCCACCCGCAAGGGCCAGACCAAGAACATCCAG
GTACTCGACCAAGTTCGAATTACCGAGTTGTGGATGAAATCCAGCATTTTCCTTCATAGTCGGACCGGCCATCCA
CGCATAGCCTTTCTTTACAAGACACAGCTCGACCACGAAGAGGCGCGCATTGCCATTTACAGACTGACAAGGGAC
GACAAGGGGGATGATGTCTCCCGCTTCGATTCACAAAAGGAAAGAGAGCTTGACCATGTTATCTGCGATCCATAT
GCATCGATACTTATCCCAGTCCCCGTGGTCGAAGAGAAGCGTTACCATGTGCGGAACAACAAGGGCGCCAGGCCT
CACCTGGGTGGTGTCCTGGTGGTGGGAGAGACGGTACTGACCTACTTTGACAGTCTCACATATATGAGTGTCACT
GAAACTCTCCCAGAGCCCAAGTTGTACGTGGCCTGGGCTGAATACGACGGCATATGCTACTTCCTGGCCGATGAC
TACGGCTGTATAGATCTCTTGACTATAGAAACAGTCCACGAGCTTACAGGCGTTGTAATCACGGGCATGAGCGTG
ACTCGAATGCGCCTTGCGGATCCCATGTCGCACATTTCGCGAGCGTCAAATCTTGTGTACATGGGAAACGACATG
TTGTTTCTGGCCTCACACCATGGTGATTCGCAGCTGCTACGGGTCAATGTTGTGGAACAAACATTGACAGTAGTT
CAAACCCTGTCAAACAATGCGCCCATTCTCGACTTTACCATTATGGACATGGGAAACCGTCAAGCTGACACCCAA
GTCACCAGCGCTTTTTCCTCGGGACAGGCAAGAATTGTGGCGGGCTGTGGCGCCTACAATGACGGGAGCCTGCGC
AGTATTCGCAGCGGTGTCGGCCTTCACGACGATGGCGTTCTCGATGACATTGTGGGAACCCGCGGACTGTTTGCC
CTGCGCTCGTCTGGTGCGGCCAAGGTGGACATGCTCGTCGTATCGTCTGTAGCTGAGACTAGGATTCTCCGGTTT
GACGCCAGTGGAGGCATCGAAGAGATTTTCGAATTTCATGGCATGGCTTTGGACCGAGAGACGCTGCTGGCAGCC
AACCTTGACGACGGAACCCTGCTCCAAGTGACGCCGCACTCGGTTAGAGTGCTGAGCATGGCCAGCGACATGGAG
GTGTGTGCTTGGAAACCTCCACAGGGAAAATCCATCACCACTGCGTCCTGCAATGGCCAGTGGGCTCTGGTGGCC
GTGGAGGGAACGACTTTGGTGTCACTCAACTTGCTCGACAACCTGGCCGCAGCATCCAAGGATGCGAAGCCAAAC
TCGACGTCGGGCGACAAAGACCAGATATCCTGCTTACATGCAGCCAGGAGTCCTTCGGGTCTGGGCGTGGTGGGC
TGGTGGTCTGCTGGAACAATATCCATTGTCGACCTGGCCACCCTGGAGCCGCTTCACGGCGAGTCTTTGCGGAAA
ACAGAGGATAGCGCCTCTATTGCGCGAGACATTGCCCTCGTACAGCTCCATCCGCCAAGCACAGGCGAATCGACG
TTACTCGTCGCAATGGAGGACGGCAGCGTGGTAACCTTTCAGGTGACACTCAAGGAATTCTTTATATCTGGCCGC
AAAAGTGTTACCCTGGGCAGCAGCCCTGCCAGGCTGCACATTCTGCCTCAGGATGACGGCACTTGCAACGTTTTT
GCCACGACTGAGCATGCCAGCCTGATTTACAGTAGCGAGGGTCGCATTGTCTTTTCGGCCACGTCTGCAAATGAT
GCCACGTACGTGGTTCCTTTTGACTCGGTGGCTTTCCCCAAGTCGGTCATCATGGCGACAGATTCTCACTTGCAG
CTGTGTCGCATCGACAAGGAGCGTCTCACGCACGTCAAGGCATTGCCGCTACGTGAAACAGTGCGCCGCGTTGCT
TACTCGCCCGGACTCAAGGCCTTTGGTTTGGGGTGCATAAAAAAGGAACTGGTGGATAGTGACGAGGTAATCACA
AGCTCCTTCAAGCTGGTGGATGAAGTTGTATTCCAGCAATTGGGGAAGCCTTTCATGCTCGATGCATCGGCCACG
CTTGAAATGGTGGAGAGTGTCATCCGCGCCGAACTGCCAGATAGCGGTGGTGTGCCTACAGAGCGCTTTATTGTG
GGAACCAGCTTCCTCACGGACGAGGAAATGGTAGAGGATGGAGACGTGCGCGGGCGCATCTTGGTTCTTGGAGTC
GACTCTGACCGACAGGTGTATCAAGTGCTTTCGCATAAACTCAAGGGATCGTGCCGCTGCCTGGGAGTCATGGGC
AACTACGTTGTGGCTGGTCTCTCCAAGACAGTTGTGGTTTACAGTTATAGCCAAGAGACGACGGCATCCGGATCC
TTGCATAAAATGGCGGCATACCGGACGTCGTCGTACCCCATTGACTTGGACATAGCGGGCAACATGATTGGCATC
GTTGATCTCATGCAGTCACTCTGTCTCGTTGAGTTTGTGCCTCCACACGACGGGGCTCAAGCAGAATTAGTAGAG
CGAGGCCGGCATCATGAACCGACTTGGGCAACTTCGGTGTGCTACTTGGATGGAGGAAGATGGCTAGAGGCCGAC
GCCCAAGGCAACCTAATGGTTTTGAGGAGAAACGAGGAGGCACCGGCGGAGCGAGAAAGATGTCGACTCGAAGTG
ACGAGTGACATCAATGTTGGAGAGCAAATTAATCGAATACGGAGGCTGCAGGCAGTTCAGCAGGAAAATGCCATT
GTGACTCCCAAAGCCTTTCTGGCATCGGTAAGGAGCATGCCTGCGTTACGAGGAGCGTGTCTTGGGTGCTGACGG
AAGCTGCCACAGGTTGAGGGCGCGCTGTACCTCTTTGGAGAAATATCTCCCGAATACCAAGACCTTCTCATTACA
TTTCAAGAGAGATTGTCGGCTTGTTTCTGCCTGCTAGGAGATGAGGAATCGGGAAAAGTAAGATTTGAAGAGTGG
CGAGCCTTTCGCGGCCAGACACGGACCGGCGAGGGGCCGTATAGGTTTATTGACGGGGAAATGCTGGAGAGGTTT
TTGGATCTCAGCGAAAGGGAGCAGAAGAGCGTGTGTGAAGGATTAGGGCCGAGCATGGAGCATCTGCGGAGCATG
GTGGAAGAACTAAGACTAATGCACTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail