Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|3978
Gene name
LocationContig_315:13858..14773
Strand-
Gene length (bp)915
Transcript length (bp)711
Coding sequence length (bp)711
Protein length (aa) 237

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00355 Rieske Rieske [2Fe-2S] domain 1.4E-10 167 222
PF02921 UCR_TM Ubiquinol cytochrome reductase transmembrane region 7.1E-10 59 107

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P07056|UCRI_NEUCR Cytochrome b-c1 complex subunit Rieske, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=NCU06606 PE=3 SV=1 31 236 2.0E-123
sp|Q09154|UCRI_SCHPO Cytochrome b-c1 complex subunit Rieske, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rip1 PE=2 SV=2 57 236 1.0E-95
sp|P08067|UCRI_YEAST Cytochrome b-c1 complex subunit Rieske, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RIP1 PE=1 SV=1 25 236 1.0E-91
sp|Q69BJ7|UCRI_SAISC Cytochrome b-c1 complex subunit Rieske, mitochondrial OS=Saimiri sciureus GN=UQCRFS1 PE=3 SV=1 57 236 7.0E-78
sp|Q69BJ9|UCRI_AOTAZ Cytochrome b-c1 complex subunit Rieske, mitochondrial OS=Aotus azarae GN=UQCRFS1 PE=3 SV=1 57 236 2.0E-77
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P07056|UCRI_NEUCR Cytochrome b-c1 complex subunit Rieske, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=NCU06606 PE=3 SV=1 31 236 2.0E-123
sp|Q09154|UCRI_SCHPO Cytochrome b-c1 complex subunit Rieske, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rip1 PE=2 SV=2 57 236 1.0E-95
sp|P08067|UCRI_YEAST Cytochrome b-c1 complex subunit Rieske, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RIP1 PE=1 SV=1 25 236 1.0E-91
sp|Q69BJ7|UCRI_SAISC Cytochrome b-c1 complex subunit Rieske, mitochondrial OS=Saimiri sciureus GN=UQCRFS1 PE=3 SV=1 57 236 7.0E-78
sp|Q69BJ9|UCRI_AOTAZ Cytochrome b-c1 complex subunit Rieske, mitochondrial OS=Aotus azarae GN=UQCRFS1 PE=3 SV=1 57 236 2.0E-77
sp|P47985|UCRI_HUMAN Cytochrome b-c1 complex subunit Rieske, mitochondrial OS=Homo sapiens GN=UQCRFS1 PE=1 SV=2 57 236 3.0E-77
sp|Q69BK5|UCRI_PANTR Cytochrome b-c1 complex subunit Rieske, mitochondrial OS=Pan troglodytes GN=UQCRFS1 PE=3 SV=1 57 236 3.0E-77
sp|Q69BK6|UCRI_PANPA Cytochrome b-c1 complex subunit Rieske, mitochondrial OS=Pan paniscus GN=UQCRFS1 PE=3 SV=1 57 236 3.0E-77
sp|Q69BK4|UCRI_GORGO Cytochrome b-c1 complex subunit Rieske, mitochondrial OS=Gorilla gorilla gorilla GN=UQCRFS1 PE=3 SV=1 57 236 3.0E-77
sp|Q69BK3|UCRI_PONPY Cytochrome b-c1 complex subunit Rieske, mitochondrial OS=Pongo pygmaeus GN=UQCRFS1 PE=3 SV=1 57 236 6.0E-77
sp|P13272|UCRI_BOVIN Cytochrome b-c1 complex subunit Rieske, mitochondrial OS=Bos taurus GN=UQCRFS1 PE=1 SV=3 57 236 1.0E-76
sp|Q5ZLR5|UCRI_CHICK Cytochrome b-c1 complex subunit Rieske, mitochondrial OS=Gallus gallus GN=UQCRFS1 PE=1 SV=1 56 236 3.0E-76
sp|Q69BJ8|UCRI_LAGLA Cytochrome b-c1 complex subunit Rieske, mitochondrial OS=Lagothrix lagotricha GN=UQCRFS1 PE=3 SV=1 57 236 4.0E-76
sp|Q69BJ6|UCRI_SYMSY Cytochrome b-c1 complex subunit Rieske, mitochondrial OS=Symphalangus syndactylus GN=UQCRFS1 PE=3 SV=1 57 236 5.0E-76
sp|Q69BK2|UCRI_THEGE Cytochrome b-c1 complex subunit Rieske, mitochondrial OS=Theropithecus gelada GN=UQCRFS1 PE=3 SV=1 57 236 8.0E-76
sp|Q69BK0|UCRI_COLPO Cytochrome b-c1 complex subunit Rieske, mitochondrial OS=Colobus polykomos GN=UQCRFS1 PE=3 SV=1 57 236 1.0E-75
sp|Q9CR68|UCRI_MOUSE Cytochrome b-c1 complex subunit Rieske, mitochondrial OS=Mus musculus GN=Uqcrfs1 PE=1 SV=1 57 236 2.0E-75
sp|P20788|UCRI_RAT Cytochrome b-c1 complex subunit Rieske, mitochondrial OS=Rattus norvegicus GN=Uqcrfs1 PE=1 SV=2 57 236 3.0E-75
sp|P0C7P4|UCRIL_HUMAN Putative cytochrome b-c1 complex subunit Rieske-like protein 1 OS=Homo sapiens GN=UQCRFS1P1 PE=5 SV=1 57 236 3.0E-75
sp|P37841|UCRI_SOLTU Cytochrome b-c1 complex subunit Rieske, mitochondrial OS=Solanum tuberosum GN=FES1 PE=1 SV=1 71 236 1.0E-74
sp|Q69BK1|UCRI_CHLAE Cytochrome b-c1 complex subunit Rieske, mitochondrial OS=Chlorocebus aethiops GN=UQCRFS1 PE=3 SV=1 57 236 3.0E-74
sp|P49727|UCRI_MAIZE Cytochrome b-c1 complex subunit Rieske, mitochondrial OS=Zea mays PE=2 SV=1 60 236 4.0E-74
sp|P51135|UCRI5_TOBAC Cytochrome b-c1 complex subunit Rieske-5, mitochondrial OS=Nicotiana tabacum PE=2 SV=1 71 236 4.0E-74
sp|P51133|UCRI3_TOBAC Cytochrome b-c1 complex subunit Rieske-3, mitochondrial OS=Nicotiana tabacum PE=2 SV=1 71 236 5.0E-74
sp|P51132|UCRI2_TOBAC Cytochrome b-c1 complex subunit Rieske-2, mitochondrial OS=Nicotiana tabacum PE=2 SV=1 71 236 2.0E-73
sp|P51134|UCRI4_TOBAC Cytochrome b-c1 complex subunit Rieske-4, mitochondrial OS=Nicotiana tabacum PE=2 SV=1 71 236 3.0E-73
sp|P49729|UCRI1_TOBAC Cytochrome b-c1 complex subunit Rieske-1, mitochondrial (Fragment) OS=Nicotiana tabacum PE=2 SV=1 71 236 3.0E-73
sp|P23136|UCRI_RHORU Ubiquinol-cytochrome c reductase iron-sulfur subunit OS=Rhodospirillum rubrum GN=petA PE=1 SV=2 65 236 8.0E-64
sp|Q4UKR6|UCRI_RICFE Ubiquinol-cytochrome c reductase iron-sulfur subunit OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=petA PE=3 SV=1 78 236 1.0E-58
sp|Q92IR2|UCRI_RICCN Ubiquinol-cytochrome c reductase iron-sulfur subunit OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=petA PE=3 SV=1 78 236 3.0E-57
sp|Q1RIA5|UCRI_RICBR Ubiquinol-cytochrome c reductase iron-sulfur subunit OS=Rickettsia bellii (strain RML369-C) GN=petA PE=3 SV=1 78 236 4.0E-55
sp|P51130|UCRI_BRADU Ubiquinol-cytochrome c reductase iron-sulfur subunit OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=petA PE=2 SV=1 98 236 6.0E-51
sp|Q9ZDQ5|UCRI_RICPR Ubiquinol-cytochrome c reductase iron-sulfur subunit OS=Rickettsia prowazekii (strain Madrid E) GN=petA PE=3 SV=1 78 236 9.0E-51
sp|P05417|UCRI_PARDE Ubiquinol-cytochrome c reductase iron-sulfur subunit OS=Paracoccus denitrificans GN=petA PE=1 SV=1 99 236 2.0E-50
sp|D5ANZ2|UCRI_RHOCB Ubiquinol-cytochrome c reductase iron-sulfur subunit OS=Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003) GN=petA PE=3 SV=1 71 236 2.0E-50
sp|P0CY48|UCRI_RHOCA Ubiquinol-cytochrome c reductase iron-sulfur subunit OS=Rhodobacter capsulatus GN=petA PE=1 SV=1 71 236 3.0E-50
sp|Q68XA0|UCRI_RICTY Ubiquinol-cytochrome c reductase iron-sulfur subunit OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=petA PE=3 SV=1 78 236 3.0E-50
sp|P81380|UCRI_BLAVI Ubiquinol-cytochrome c reductase iron-sulfur subunit OS=Blastochloris viridis GN=petA PE=3 SV=2 98 236 8.0E-50
sp|Q02762|UCRI_RHOSH Ubiquinol-cytochrome c reductase iron-sulfur subunit OS=Rhodobacter sphaeroides GN=petA PE=1 SV=1 99 236 1.0E-42
sp|O31214|UCRI_ALLVD Ubiquinol-cytochrome c reductase iron-sulfur subunit OS=Allochromatium vinosum (strain ATCC 17899 / DSM 180 / NBRC 103801 / NCIMB 10441 / D) GN=petA PE=3 SV=2 61 236 3.0E-28
sp|O49078|UCRIA_FRIAG Cytochrome b6-f complex iron-sulfur subunit, chloroplastic OS=Fritillaria agrestis GN=petC PE=2 SV=1 178 234 4.0E-11
sp|Q9ZR03|UCRIA_ARATH Cytochrome b6-f complex iron-sulfur subunit, chloroplastic OS=Arabidopsis thaliana GN=petC PE=1 SV=1 177 234 5.0E-11
sp|A3PBI5|UCRI_PROM0 Cytochrome b6-f complex iron-sulfur subunit OS=Prochlorococcus marinus (strain MIT 9301) GN=petC PE=3 SV=1 178 234 1.0E-10
sp|A8G3H7|UCRI_PROM2 Cytochrome b6-f complex iron-sulfur subunit OS=Prochlorococcus marinus (strain MIT 9215) GN=petC PE=3 SV=1 178 234 2.0E-10
sp|Q31C72|UCRI_PROM9 Cytochrome b6-f complex iron-sulfur subunit OS=Prochlorococcus marinus (strain MIT 9312) GN=petC PE=3 SV=1 178 234 2.0E-10
sp|A2BPU5|UCRI_PROMS Cytochrome b6-f complex iron-sulfur subunit OS=Prochlorococcus marinus (strain AS9601) GN=petC PE=3 SV=1 178 234 2.0E-10
sp|Q7VDC0|UCRI_PROMA Cytochrome b6-f complex iron-sulfur subunit OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=petC PE=3 SV=1 178 234 3.0E-10
sp|A9BE84|UCRI_PROM4 Cytochrome b6-f complex iron-sulfur subunit OS=Prochlorococcus marinus (strain MIT 9211) GN=petC PE=3 SV=1 178 235 1.0E-09
sp|Q5CC92|UCRIB_CYAPA Cytochrome b6-f complex iron-sulfur subunit 2, cyanelle OS=Cyanophora paradoxa GN=petC-2 PE=2 SV=1 178 231 1.0E-09
sp|P26290|UCRIB_SYNY3 Cytochrome b6-f complex iron-sulfur subunit 2 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=petC2 PE=3 SV=2 178 235 2.0E-09
sp|Q5CC93|UCRIA_CYAPA Cytochrome b6-f complex iron-sulfur subunit 1, cyanelle OS=Cyanophora paradoxa GN=petC-1 PE=2 SV=1 178 231 2.0E-09
sp|P0C8N7|UCRI_SYNEL Cytochrome b6-f complex iron-sulfur subunit OS=Synechococcus elongatus GN=petC PE=3 SV=1 178 234 2.0E-09
sp|P0C8N8|UCRI_THEEB Cytochrome b6-f complex iron-sulfur subunit OS=Thermosynechococcus elongatus (strain BP-1) GN=petC PE=1 SV=1 178 234 2.0E-09
sp|P26291|UCRIA_PEA Cytochrome b6-f complex iron-sulfur subunit, chloroplastic OS=Pisum sativum GN=petC PE=2 SV=1 178 234 2.0E-09
sp|A2C0R9|UCRI_PROM1 Cytochrome b6-f complex iron-sulfur subunit OS=Prochlorococcus marinus (strain NATL1A) GN=petC PE=3 SV=1 178 234 2.0E-09
sp|Q46GW1|UCRI_PROMT Cytochrome b6-f complex iron-sulfur subunit OS=Prochlorococcus marinus (strain NATL2A) GN=petC PE=3 SV=1 178 234 2.0E-09
sp|P08980|UCRIA_SPIOL Cytochrome b6-f complex iron-sulfur subunit, chloroplastic OS=Spinacia oleracea GN=petC PE=1 SV=2 177 234 3.0E-09
sp|Q9SBN3|UCRIA_VOLCA Cytochrome b6-f complex iron-sulfur subunit, chloroplastic OS=Volvox carteri GN=petC PE=2 SV=1 178 231 3.0E-09
sp|P49728|UCRIA_CHLRE Cytochrome b6-f complex iron-sulfur subunit, chloroplastic OS=Chlamydomonas reinhardtii GN=petC PE=1 SV=1 178 231 5.0E-09
sp|Q02585|UCRIB_TOBAC Cytochrome b6-f complex iron-sulfur subunit 2, chloroplastic OS=Nicotiana tabacum GN=petC2 PE=2 SV=1 177 234 5.0E-09
sp|P26292|UCRI_SYNP2 Cytochrome b6-f complex iron-sulfur subunit OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=petC PE=3 SV=1 178 233 5.0E-09
sp|P30361|UCRIA_TOBAC Cytochrome b6-f complex iron-sulfur subunit 1, chloroplastic OS=Nicotiana tabacum GN=petC1 PE=2 SV=2 177 234 6.0E-09
sp|Q69S39|UCRIA_ORYSJ Cytochrome b6-f complex iron-sulfur subunit, chloroplastic OS=Oryza sativa subsp. japonica GN=petC PE=1 SV=1 178 234 6.0E-09
sp|A5GRU8|UCRI_SYNR3 Cytochrome b6-f complex iron-sulfur subunit OS=Synechococcus sp. (strain RCC307) GN=petC PE=3 SV=1 178 234 9.0E-09
sp|A2BVC4|UCRI_PROM5 Cytochrome b6-f complex iron-sulfur subunit OS=Prochlorococcus marinus (strain MIT 9515) GN=petC PE=3 SV=1 178 222 1.0E-08
sp|Q7V2L4|UCRI_PROMP Cytochrome b6-f complex iron-sulfur subunit OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=petC PE=3 SV=1 178 222 1.0E-08
sp|B0JXB7|UCRI_MICAN Cytochrome b6-f complex iron-sulfur subunit OS=Microcystis aeruginosa (strain NIES-843) GN=petC PE=3 SV=1 178 234 1.0E-08
sp|Q7X9A6|UCRIA_WHEAT Cytochrome b6-f complex iron-sulfur subunit, chloroplastic OS=Triticum aestivum GN=petC PE=2 SV=1 178 234 1.0E-08
sp|Q114L6|UCRI_TRIEI Cytochrome b6-f complex iron-sulfur subunit OS=Trichodesmium erythraeum (strain IMS101) GN=petC PE=3 SV=1 178 234 2.0E-08
sp|Q3AWL7|UCRI_SYNS9 Cytochrome b6-f complex iron-sulfur subunit OS=Synechococcus sp. (strain CC9902) GN=petC PE=3 SV=1 160 234 2.0E-08
sp|Q69GY7|UCRIA_SOLTU Cytochrome b6-f complex iron-sulfur subunit, chloroplastic OS=Solanum tuberosum GN=petC PE=2 SV=1 178 234 3.0E-08
sp|Q0I872|UCRI_SYNS3 Cytochrome b6-f complex iron-sulfur subunit OS=Synechococcus sp. (strain CC9311) GN=petC PE=3 SV=1 178 234 3.0E-08
sp|Q5N5B0|UCRI_SYNP6 Cytochrome b6-f complex iron-sulfur subunit OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=petC PE=3 SV=1 178 230 3.0E-08
sp|Q31NV7|UCRI_SYNE7 Cytochrome b6-f complex iron-sulfur subunit OS=Synechococcus elongatus (strain PCC 7942) GN=petC PE=3 SV=1 178 230 3.0E-08
sp|Q7U566|UCRI_SYNPX Cytochrome b6-f complex iron-sulfur subunit OS=Synechococcus sp. (strain WH8102) GN=petC PE=3 SV=1 160 222 4.0E-08
sp|Q3ALY0|UCRI_SYNSC Cytochrome b6-f complex iron-sulfur subunit OS=Synechococcus sp. (strain CC9605) GN=petC PE=3 SV=1 160 222 4.0E-08
sp|A5GMW1|UCRI_SYNPW Cytochrome b6-f complex iron-sulfur subunit OS=Synechococcus sp. (strain WH7803) GN=petC PE=3 SV=1 178 222 4.0E-08
sp|P83794|UCRI_MASLA Cytochrome b6-f complex iron-sulfur subunit OS=Mastigocladus laminosus GN=petC PE=1 SV=2 177 222 7.0E-08
sp|B8HNR1|UCRI_CYAP4 Cytochrome b6-f complex iron-sulfur subunit OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=petC PE=3 SV=1 178 222 1.0E-07
sp|A2C7F6|UCRI_PROM3 Cytochrome b6-f complex iron-sulfur subunit OS=Prochlorococcus marinus (strain MIT 9303) GN=petC PE=3 SV=1 142 222 1.0E-07
sp|Q7V654|UCRI_PROMM Cytochrome b6-f complex iron-sulfur subunit OS=Prochlorococcus marinus (strain MIT 9313) GN=petC PE=3 SV=2 142 222 1.0E-07
sp|B2J3K2|UCRI_NOSP7 Cytochrome b6-f complex iron-sulfur subunit OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=petC PE=3 SV=1 178 230 2.0E-07
sp|P14698|UCRI_NOSSP Cytochrome b6-f complex iron-sulfur subunit OS=Nostoc sp. (strain PCC 7906) GN=petC PE=3 SV=1 178 222 2.0E-07
sp|Q2JUP1|UCRI_SYNJA Cytochrome b6-f complex iron-sulfur subunit OS=Synechococcus sp. (strain JA-3-3Ab) GN=petC PE=3 SV=1 178 222 2.0E-07
sp|Q93SX0|UCRIA_NOSS1 Cytochrome b6-f complex iron-sulfur subunit 1 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=petC1 PE=1 SV=1 178 222 3.0E-07
sp|Q46136|UCRI_CHLTI Cytochrome b6-f complex iron-sulfur subunit OS=Chlorobaculum thiosulfatiphilum GN=petC PE=1 SV=2 178 235 3.0E-07
sp|Q9L3P9|UCRIA_ANAVT Cytochrome b6-f complex iron-sulfur subunit 1 OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=petC PE=3 SV=1 178 222 3.0E-07
sp|Q2JL39|UCRI_SYNJB Cytochrome b6-f complex iron-sulfur subunit OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=petC PE=3 SV=1 178 222 9.0E-07
sp|Q9F722|UCRI_CHLTE Cytochrome b6-f complex iron-sulfur subunit OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=petC PE=3 SV=4 178 235 2.0E-06
sp|Q7XYM4|UCRIA_BIGNA Cytochrome b6-f complex iron-sulfur subunit, chloroplastic OS=Bigelowiella natans GN=petC PE=2 SV=1 177 235 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0008121 ubiquinol-cytochrome-c reductase activity Yes
GO:0051537 2 iron, 2 sulfur cluster binding Yes
GO:0016679 oxidoreductase activity, acting on diphenols and related substances as donors No
GO:0015078 proton transmembrane transporter activity No
GO:0022853 active ion transmembrane transporter activity No
GO:0022804 active transmembrane transporter activity No
GO:0015453 oxidoreduction-driven active transmembrane transporter activity No
GO:0051536 iron-sulfur cluster binding No
GO:0008324 cation transmembrane transporter activity No
GO:0015318 inorganic molecular entity transmembrane transporter activity No
GO:0015075 ion transmembrane transporter activity No
GO:0005488 binding No
GO:0015399 primary active transmembrane transporter activity No
GO:0022857 transmembrane transporter activity No
GO:0022890 inorganic cation transmembrane transporter activity No
GO:0003674 molecular_function No
GO:0009055 electron transfer activity No
GO:0051540 metal cluster binding No
GO:0003824 catalytic activity No
GO:0016491 oxidoreductase activity No
GO:0005215 transporter activity No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup6293
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3978 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|4645
Ophiocordyceps camponoti-floridani Ophcf2|02872
Ophiocordyceps kimflemingae Ophio5|1081
Ophiocordyceps subramaniannii Hirsu2|8636

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|3978
MASLATAASRTCLAAGRRMSKPGVPAGLRALSMTPARGAGSETTYKAPFGGDKGNSIPDFGKYVSSRSPASNKLF
QYFMVGTMGAITAAGAKSTVQEFLVNMSASADVLALAKVEVDLNAIPEGKNVLVKWRGKPVFIRHRTPEEIEQAN
KVNVATLRDPQTDEERVKKPEWLIMLGVCTHLGCVPIGEAGDFGGWFCPCHGSHYDISGRIRKGPAPLNLEIPQY
DFPEEGKLIVG*
Coding >OphauG2|3978
ATGGCCTCACTGGCAACGGCCGCATCACGCACCTGCCTGGCGGCGGGGCGACGAATGAGCAAGCCGGGCGTACCG
GCAGGCCTACGGGCCCTGAGCATGACGCCGGCCCGGGGCGCGGGATCCGAGACGACGTACAAGGCGCCCTTTGGC
GGCGACAAGGGCAATTCGATTCCCGACTTTGGCAAATACGTGTCGAGTCGAAGCCCGGCTAGCAACAAGCTGTTT
CAATACTTCATGGTGGGCACCATGGGGGCAATCACGGCGGCGGGGGCCAAGAGCACTGTCCAGGAGTTCTTGGTC
AACATGTCTGCCTCGGCAGATGTCTTGGCCTTGGCCAAGGTCGAGGTTGACCTCAATGCCATCCCTGAAGGCAAG
AATGTTCTGGTCAAATGGCGCGGAAAGCCCGTCTTTATTCGCCACCGCACCCCCGAGGAAATCGAACAGGCAAAC
AAGGTCAACGTTGCTACCCTGCGCGACCCCCAGACAGACGAGGAACGTGTCAAGAAGCCCGAGTGGCTCATCATG
CTCGGCGTATGCACTCACCTCGGATGCGTCCCCATTGGCGAGGCGGGCGACTTTGGCGGCTGGTTTTGTCCCTGC
CACGGATCCCACTACGATATTTCGGGCCGGATACGAAAGGGCCCAGCGCCCCTCAACCTCGAAATCCCACAGTAC
GACTTTCCCGAGGAGGGCAAGCTTATTGTTGGCTAG
Transcript >OphauG2|3978
ATGGCCTCACTGGCAACGGCCGCATCACGCACCTGCCTGGCGGCGGGGCGACGAATGAGCAAGCCGGGCGTACCG
GCAGGCCTACGGGCCCTGAGCATGACGCCGGCCCGGGGCGCGGGATCCGAGACGACGTACAAGGCGCCCTTTGGC
GGCGACAAGGGCAATTCGATTCCCGACTTTGGCAAATACGTGTCGAGTCGAAGCCCGGCTAGCAACAAGCTGTTT
CAATACTTCATGGTGGGCACCATGGGGGCAATCACGGCGGCGGGGGCCAAGAGCACTGTCCAGGAGTTCTTGGTC
AACATGTCTGCCTCGGCAGATGTCTTGGCCTTGGCCAAGGTCGAGGTTGACCTCAATGCCATCCCTGAAGGCAAG
AATGTTCTGGTCAAATGGCGCGGAAAGCCCGTCTTTATTCGCCACCGCACCCCCGAGGAAATCGAACAGGCAAAC
AAGGTCAACGTTGCTACCCTGCGCGACCCCCAGACAGACGAGGAACGTGTCAAGAAGCCCGAGTGGCTCATCATG
CTCGGCGTATGCACTCACCTCGGATGCGTCCCCATTGGCGAGGCGGGCGACTTTGGCGGCTGGTTTTGTCCCTGC
CACGGATCCCACTACGATATTTCGGGCCGGATACGAAAGGGCCCAGCGCCCCTCAACCTCGAAATCCCACAGTAC
GACTTTCCCGAGGAGGGCAAGCTTATTGTTGGCTAG
Gene >OphauG2|3978
ATGGCCTCACTGGCAACGGCCGCATCACGCACCTGCCTGGCGGCGGGGCGACGAATGAGCAAGCCGGGCGTACCG
GCAGGCCTACGGGCCCTGAGCATGACGCCGGCCCGGGGCGCGGGATCCGAGACGACGTACAAGGCGCCCTTTGGC
GGCGACAAGGGCAATTCGATTCCCGACTTTGGCAAATACGTGTCGAGTCGAAGCCCGGCTAGCAACAAGCTGTTT
CAATACTTCATGGTGGGCACCATGGGGGCAATCACGGCGGCGGGGGCCAAGAGCACTGTCCAGGGTTGGTATTTG
GTGCTTTGAAGGGGCTTTTGGCTCTTGGTTGCAGCCGCTTTGCTGATGCGCGACGACAGAGTTCTTGGTCAACAT
GTCTGCCTCGGCAGATGTCTTGGCCTTGGCCAAGGTCGAGGTTGACCTCAATGCCATCCCTGAAGGCAAGAATGT
AGGCTCTCGCTTCTTGCCGTCTCTGCCGTCTCGGCCCCTCCTACACCCGGCTTACGCGCCTAGGTTCTGGTCAAA
TGGCGCGGAAAGCCCGTCTTTATTCGCCACCGCACCCCCGAGGAAATCGAACAGGCAAACAAGGTCAACGTTGCT
ACCCTGCGCGACCCCCAGACAGACGAGGAACGTGTCAAGAAGCCCGAGTGGCTCATCATGCTCGGTAAACCCCCC
TCTCCTCTCTCCTTGCATCCTCCCGCTTTCTTTTCACATGGCCGCTCACAGCTCTTAGGCGTATGCACTCACCTC
GGATGCGTCCCCATTGGCGAGGCGGGCGACTTTGGCGGCTGGTTTTGTCCCTGCCACGGATCCCACTACGATATT
TCGGGCCGGATACGAAAGGGCCCAGCGCCCCTCAACCTCGAAATCCCACAGTACGACTTTCCCGAGGAGGGCAAG
CTTATTGTTGGCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail