Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|3976
Gene name
LocationContig_315:9081..10811
Strand-
Gene length (bp)1730
Transcript length (bp)1674
Coding sequence length (bp)1674
Protein length (aa) 558

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09180 ProRS-C_1 Prolyl-tRNA synthetase, C-terminal 1.3E-22 465 557
PF00587 tRNA-synt_2b tRNA synthetase class II core domain (G, H, P, S and T) 1.0E-19 151 319
PF03129 HGTP_anticodon Anticodon binding domain 6.8E-16 340 438

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O60155|PRS1_SCHPO Putative proline--tRNA ligase C19C7.06 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prs1 PE=3 SV=1 47 557 0.0E+00
sp|P38708|YHI0_YEAST Putative proline--tRNA ligase YHR020W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YHR020W PE=1 SV=1 47 557 0.0E+00
sp|P28668|SYEP_DROME Bifunctional glutamate/proline--tRNA ligase OS=Drosophila melanogaster GN=Aats-glupro PE=1 SV=2 15 557 0.0E+00
sp|Q9M1R2|SYPC_ARATH Proline--tRNA ligase, cytoplasmic OS=Arabidopsis thaliana GN=At3g62120 PE=2 SV=1 41 557 0.0E+00
sp|Q8CGC7|SYEP_MOUSE Bifunctional glutamate/proline--tRNA ligase OS=Mus musculus GN=Eprs PE=1 SV=4 41 557 9.0E-173
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O60155|PRS1_SCHPO Putative proline--tRNA ligase C19C7.06 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prs1 PE=3 SV=1 47 557 0.0E+00
sp|P38708|YHI0_YEAST Putative proline--tRNA ligase YHR020W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YHR020W PE=1 SV=1 47 557 0.0E+00
sp|P28668|SYEP_DROME Bifunctional glutamate/proline--tRNA ligase OS=Drosophila melanogaster GN=Aats-glupro PE=1 SV=2 15 557 0.0E+00
sp|Q9M1R2|SYPC_ARATH Proline--tRNA ligase, cytoplasmic OS=Arabidopsis thaliana GN=At3g62120 PE=2 SV=1 41 557 0.0E+00
sp|Q8CGC7|SYEP_MOUSE Bifunctional glutamate/proline--tRNA ligase OS=Mus musculus GN=Eprs PE=1 SV=4 41 557 9.0E-173
sp|P07814|SYEP_HUMAN Bifunctional glutamate/proline--tRNA ligase OS=Homo sapiens GN=EPRS PE=1 SV=5 41 557 2.0E-171
sp|Q8SSD7|SYP_ENCCU Proline--tRNA ligase OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU02_1360 PE=1 SV=2 48 557 4.0E-170
sp|Q8I5R7|SYP_PLAF7 Proline--tRNA ligase OS=Plasmodium falciparum (isolate 3D7) GN=proRS PE=1 SV=1 43 557 2.0E-158
sp|B9LUM0|SYP_HALLT Proline--tRNA ligase OS=Halorubrum lacusprofundi (strain ATCC 49239 / DSM 5036 / JCM 8891 / ACAM 34) GN=proS PE=3 SV=1 45 557 2.0E-126
sp|Q18CD7|SYP2_PEPD6 Proline--tRNA ligase 2 OS=Peptoclostridium difficile (strain 630) GN=proS2 PE=3 SV=1 56 557 8.0E-126
sp|Q8ESQ5|SYP_OCEIH Proline--tRNA ligase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=proS PE=3 SV=1 41 557 2.0E-125
sp|A0RUI8|SYP_CENSY Proline--tRNA ligase OS=Cenarchaeum symbiosum (strain A) GN=proS PE=3 SV=1 48 521 3.0E-125
sp|B2A5T8|SYP_NATTJ Proline--tRNA ligase OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=proS PE=3 SV=1 41 557 5.0E-125
sp|Q73E50|SYP2_BACC1 Proline--tRNA ligase 2 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=proS2 PE=3 SV=1 56 557 5.0E-123
sp|A0Q2I3|SYP_CLONN Proline--tRNA ligase OS=Clostridium novyi (strain NT) GN=proS PE=3 SV=1 55 557 7.0E-123
sp|Q63GI2|SYP2_BACCZ Proline--tRNA ligase 2 OS=Bacillus cereus (strain ZK / E33L) GN=proS2 PE=3 SV=2 56 557 1.0E-122
sp|Q6HNZ7|SYP2_BACHK Proline--tRNA ligase 2 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=proS2 PE=3 SV=1 56 557 3.0E-121
sp|Q9L4Q8|SYP_CLOSD Proline--tRNA ligase OS=Clostridium sticklandii (strain ATCC 12662 / DSM 519 / JCM 1433 / NCIB 10654) GN=proS PE=1 SV=1 41 557 5.0E-121
sp|B1L224|SYP_CLOBM Proline--tRNA ligase OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=proS PE=3 SV=1 55 557 7.0E-121
sp|A0R9A0|SYP2_BACAH Proline--tRNA ligase 2 OS=Bacillus thuringiensis (strain Al Hakam) GN=proS2 PE=3 SV=2 56 557 9.0E-121
sp|Q18JG3|SYP_HALWD Proline--tRNA ligase OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=proS PE=3 SV=1 45 494 2.0E-120
sp|C3KUV8|SYP_CLOB6 Proline--tRNA ligase OS=Clostridium botulinum (strain 657 / Type Ba4) GN=proS PE=3 SV=1 55 557 3.0E-120
sp|Q81IE9|SYP2_BACCR Proline--tRNA ligase 2 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=proS2 PE=3 SV=1 56 557 9.0E-120
sp|Q67PA6|SYP_SYMTH Proline--tRNA ligase OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=proS PE=3 SV=1 54 557 1.0E-119
sp|C1FM10|SYP_CLOBJ Proline--tRNA ligase OS=Clostridium botulinum (strain Kyoto / Type A2) GN=proS PE=3 SV=1 55 557 1.0E-119
sp|A5I768|SYP_CLOBH Proline--tRNA ligase OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=proS PE=3 SV=1 55 557 1.0E-119
sp|A7FYU0|SYP_CLOB1 Proline--tRNA ligase OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=proS PE=3 SV=1 55 557 1.0E-119
sp|B1IFI2|SYP_CLOBK Proline--tRNA ligase OS=Clostridium botulinum (strain Okra / Type B1) GN=proS PE=3 SV=1 55 557 3.0E-119
sp|A7GIT0|SYP_CLOBL Proline--tRNA ligase OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=proS PE=3 SV=1 55 557 4.0E-119
sp|A8MLB3|SYP_ALKOO Proline--tRNA ligase OS=Alkaliphilus oremlandii (strain OhILAs) GN=proS PE=3 SV=1 57 557 7.0E-119
sp|Q9HS52|SYP_HALSA Proline--tRNA ligase OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=proS PE=3 SV=2 45 494 9.0E-119
sp|B0R3A3|SYP_HALS3 Proline--tRNA ligase OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=proS PE=3 SV=1 45 494 9.0E-119
sp|Q81Z76|SYP2_BACAN Proline--tRNA ligase 2 OS=Bacillus anthracis GN=proS2 PE=3 SV=1 56 543 1.0E-118
sp|Q027I0|SYP_SOLUE Proline--tRNA ligase OS=Solibacter usitatus (strain Ellin6076) GN=proS PE=3 SV=1 53 507 1.0E-118
sp|A7NKX0|SYP_ROSCS Proline--tRNA ligase OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=proS PE=3 SV=1 49 468 6.0E-117
sp|C4Z1D7|SYP_EUBE2 Proline--tRNA ligase OS=Eubacterium eligens (strain ATCC 27750 / VPI C15-48) GN=proS PE=3 SV=1 47 557 3.0E-115
sp|A5UU62|SYP_ROSS1 Proline--tRNA ligase OS=Roseiflexus sp. (strain RS-1) GN=proS PE=3 SV=1 49 468 7.0E-115
sp|B8I5R4|SYP_CLOCE Proline--tRNA ligase OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=proS PE=3 SV=1 53 557 1.0E-114
sp|Q72GF9|SYP_THET2 Proline--tRNA ligase OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=proS PE=3 SV=1 49 557 2.0E-114
sp|Q5SM28|SYP_THET8 Proline--tRNA ligase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=proS PE=1 SV=1 49 557 4.0E-114
sp|C4ZC24|SYP_EUBR3 Proline--tRNA ligase OS=Eubacterium rectale (strain ATCC 33656 / VPI 0990) GN=proS PE=3 SV=1 43 557 6.0E-114
sp|A9KL35|SYP_CLOPH Proline--tRNA ligase OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=proS PE=3 SV=1 53 557 3.0E-113
sp|Q3IS99|SYP_NATPD Proline--tRNA ligase OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=proS PE=3 SV=1 44 494 1.0E-112
sp|Q1AX25|SYP_RUBXD Proline--tRNA ligase OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=proS PE=3 SV=1 54 539 8.0E-112
sp|B9LC55|SYP_CHLSY Proline--tRNA ligase OS=Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl) GN=proS PE=3 SV=1 50 557 6.0E-111
sp|A9W9Q2|SYP_CHLAA Proline--tRNA ligase OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=proS PE=3 SV=1 50 557 6.0E-111
sp|B3EE36|SYP_CHLL2 Proline--tRNA ligase OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=proS PE=3 SV=1 53 532 1.0E-110
sp|Q5V5H0|SYP_HALMA Proline--tRNA ligase OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=proS PE=3 SV=1 48 494 1.0E-109
sp|B8G3V5|SYP_CHLAD Proline--tRNA ligase OS=Chloroflexus aggregans (strain MD-66 / DSM 9485) GN=proS PE=3 SV=1 50 557 2.0E-109
sp|B3EP23|SYP_CHLPB Proline--tRNA ligase OS=Chlorobium phaeobacteroides (strain BS1) GN=proS PE=3 SV=1 54 532 4.0E-109
sp|Q3B2T0|SYP_CHLL7 Proline--tRNA ligase OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=proS PE=3 SV=1 53 478 6.0E-109
sp|B4S9D5|SYP_PROA2 Proline--tRNA ligase OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) GN=proS PE=3 SV=1 50 532 7.0E-109
sp|Q1CXV1|SYP_MYXXD Proline--tRNA ligase OS=Myxococcus xanthus (strain DK 1622) GN=proS PE=3 SV=1 54 535 3.0E-108
sp|Q1J0W2|SYP_DEIGD Proline--tRNA ligase OS=Deinococcus geothermalis (strain DSM 11300) GN=proS PE=3 SV=1 57 557 5.0E-108
sp|Q3ASP3|SYP_CHLCH Proline--tRNA ligase OS=Chlorobium chlorochromatii (strain CaD3) GN=proS PE=3 SV=1 53 478 6.0E-108
sp|B3QYP1|SYP_CHLT3 Proline--tRNA ligase OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) GN=proS PE=3 SV=1 53 468 2.0E-107
sp|Q0SAY4|SYP2_RHOJR Proline--tRNA ligase 2 OS=Rhodococcus jostii (strain RHA1) GN=proS2 PE=3 SV=2 49 557 4.0E-107
sp|Q9Z5I7|SYP_MYCLE Proline--tRNA ligase OS=Mycobacterium leprae (strain TN) GN=proS PE=3 SV=2 49 528 6.0E-107
sp|B8ZRT2|SYP_MYCLB Proline--tRNA ligase OS=Mycobacterium leprae (strain Br4923) GN=proS PE=3 SV=1 49 528 6.0E-107
sp|B7J1X2|SYP_BORBZ Proline--tRNA ligase OS=Borrelia burgdorferi (strain ZS7) GN=proS PE=3 SV=1 53 557 5.0E-106
sp|Q9FYR6|SYPM_ARATH Proline--tRNA ligase, chloroplastic/mitochondrial OS=Arabidopsis thaliana GN=OVA6 PE=2 SV=1 54 557 1.0E-105
sp|Q661L6|SYP_BORBP Proline--tRNA ligase OS=Borrelia bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi) GN=proS PE=3 SV=1 53 557 1.0E-105
sp|Q6YQX7|SYP_ONYPE Proline--tRNA ligase OS=Onion yellows phytoplasma (strain OY-M) GN=proS PE=3 SV=1 43 467 1.0E-105
sp|B1VAN9|SYP_PHYAS Proline--tRNA ligase OS=Phytoplasma australiense GN=proS PE=3 SV=1 53 478 5.0E-105
sp|A4SFS0|SYP_CHLPM Proline--tRNA ligase OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=proS PE=3 SV=1 53 478 6.0E-105
sp|Q9RUW4|SYP_DEIRA Proline--tRNA ligase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=proS PE=1 SV=1 40 557 6.0E-105
sp|B3QPX3|SYP_CHLP8 Proline--tRNA ligase OS=Chlorobaculum parvum (strain NCIB 8327) GN=proS PE=3 SV=1 53 532 8.0E-105
sp|Q6F0Y9|SYP_MESFL Proline--tRNA ligase OS=Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1) GN=proS PE=3 SV=1 57 557 9.0E-105
sp|O51363|SYP_BORBU Proline--tRNA ligase OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=proS PE=1 SV=1 53 557 1.0E-104
sp|Q2NJ01|SYP_AYWBP Proline--tRNA ligase OS=Aster yellows witches'-broom phytoplasma (strain AYWB) GN=proS PE=3 SV=1 43 467 2.0E-104
sp|B3ER64|SYP_AMOA5 Proline--tRNA ligase OS=Amoebophilus asiaticus (strain 5a2) GN=proS PE=3 SV=1 53 535 1.0E-103
sp|Q7MVS7|SYP_PORGI Proline--tRNA ligase OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=proS PE=3 SV=1 54 557 2.0E-103
sp|Q0SNA5|SYP_BORAP Proline--tRNA ligase OS=Borrelia afzelii (strain PKo) GN=proS PE=3 SV=1 53 557 3.0E-103
sp|Q2J529|SYP_FRASC Proline--tRNA ligase OS=Frankia sp. (strain CcI3) GN=proS PE=3 SV=1 48 458 5.0E-103
sp|B2RJG1|SYP_PORG3 Proline--tRNA ligase OS=Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / JCM 12257) GN=proS PE=3 SV=1 54 557 6.0E-103
sp|Q2SSG0|SYP_MYCCT Proline--tRNA ligase OS=Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154) GN=proS PE=3 SV=2 54 557 7.0E-103
sp|A6L5I2|SYP_BACV8 Proline--tRNA ligase OS=Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / NCTC 11154) GN=proS PE=3 SV=1 54 557 1.0E-102
sp|A1BHL6|SYP_CHLPD Proline--tRNA ligase OS=Chlorobium phaeobacteroides (strain DSM 266) GN=proS PE=3 SV=1 53 532 9.0E-102
sp|B4SG51|SYP_PELPB Proline--tRNA ligase OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=proS PE=3 SV=1 53 478 1.0E-101
sp|Q6MTR9|SYP_MYCMS Proline--tRNA ligase OS=Mycoplasma mycoides subsp. mycoides SC (strain PG1) GN=proS PE=3 SV=1 54 557 3.0E-101
sp|Q8KCD1|SYP_CHLTE Proline--tRNA ligase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=proS PE=3 SV=1 53 532 3.0E-101
sp|Q98R27|SYP_MYCPU Proline--tRNA ligase OS=Mycoplasma pulmonis (strain UAB CTIP) GN=proS PE=3 SV=2 56 557 6.0E-101
sp|B6YQ92|SYP_AZOPC Proline--tRNA ligase OS=Azobacteroides pseudotrichonymphae genomovar. CFP2 GN=proS PE=3 SV=1 61 496 8.0E-101
sp|A6GZF3|SYP_FLAPJ Proline--tRNA ligase OS=Flavobacterium psychrophilum (strain JIP02/86 / ATCC 49511) GN=proS PE=3 SV=1 53 496 2.0E-100
sp|A1RYD8|SYP_THEPD Proline--tRNA ligase OS=Thermofilum pendens (strain Hrk 5) GN=proS PE=3 SV=1 49 496 5.0E-100
sp|Q0RBM4|SYP_FRAAA Proline--tRNA ligase OS=Frankia alni (strain ACN14a) GN=proS PE=3 SV=1 48 504 3.0E-99
sp|Q4A5S0|SYP_MYCS5 Proline--tRNA ligase OS=Mycoplasma synoviae (strain 53) GN=proS PE=3 SV=1 57 557 3.0E-99
sp|Q6KIE6|SYP_MYCMO Proline--tRNA ligase OS=Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711) GN=proS PE=3 SV=1 57 482 5.0E-99
sp|Q11Q45|SYP_CYTH3 Proline--tRNA ligase OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=proS PE=3 SV=1 54 473 5.0E-99
sp|A5FA31|SYP_FLAJ1 Proline--tRNA ligase OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=proS PE=3 SV=1 53 496 1.0E-98
sp|A0M4Z3|SYP_GRAFK Proline--tRNA ligase OS=Gramella forsetii (strain KT0803) GN=proS PE=3 SV=1 54 557 1.0E-98
sp|A6LAP3|SYP_PARD8 Proline--tRNA ligase OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / NCTC 11152) GN=proS PE=3 SV=1 57 557 5.0E-98
sp|Q8A988|SYP_BACTN Proline--tRNA ligase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=proS PE=3 SV=1 54 557 8.0E-98
sp|Q64TJ6|SYP_BACFR Proline--tRNA ligase OS=Bacteroides fragilis (strain YCH46) GN=proS PE=3 SV=1 54 479 1.0E-97
sp|Q5LCF0|SYP_BACFN Proline--tRNA ligase OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=proS PE=3 SV=1 54 479 1.0E-97
sp|Q2RZJ2|SYP_SALRD Proline--tRNA ligase OS=Salinibacter ruber (strain DSM 13855 / M31) GN=proS PE=3 SV=2 54 452 2.0E-96
sp|Q4A7Y3|SYP_MYCH7 Proline--tRNA ligase OS=Mycoplasma hyopneumoniae (strain 7448) GN=proS PE=3 SV=1 53 557 1.0E-95
sp|Q600Q7|SYP_MYCH2 Proline--tRNA ligase OS=Mycoplasma hyopneumoniae (strain 232) GN=proS PE=3 SV=1 53 557 2.0E-95
sp|Q4A9V2|SYP_MYCHJ Proline--tRNA ligase OS=Mycoplasma hyopneumoniae (strain J / ATCC 25934 / NCTC 10110) GN=proS PE=3 SV=1 53 557 1.0E-94
sp|Q82JV8|SYP2_STRAW Proline--tRNA ligase 2 OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=proS2 PE=3 SV=1 50 424 1.0E-94
sp|Q2ILX2|SYP2_ANADE Proline--tRNA ligase 2 OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=proS2 PE=3 SV=1 49 524 9.0E-94
sp|Q8TJA2|SYP_METAC Proline--tRNA ligase OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=proS PE=3 SV=1 55 518 1.0E-92
sp|Q8U1C4|SYP_PYRFU Proline--tRNA ligase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=proS PE=3 SV=1 55 557 5.0E-91
sp|Q6MIW2|SYP_BDEBA Proline--tRNA ligase OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=proS PE=3 SV=1 49 557 6.0E-91
sp|Q6MBK1|SYP_PARUW Proline--tRNA ligase OS=Protochlamydia amoebophila (strain UWE25) GN=proS PE=3 SV=1 44 521 1.0E-89
sp|Q9V022|SYP_PYRAB Proline--tRNA ligase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=proS PE=3 SV=1 55 557 2.0E-89
sp|Q8PYZ1|SYP_METMA Proline--tRNA ligase OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=proS PE=3 SV=1 55 515 3.0E-89
sp|Q46G28|SYP_METBF Proline--tRNA ligase OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=proS PE=3 SV=1 56 557 3.0E-89
sp|Q5JF49|SYP_THEKO Proline--tRNA ligase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=proS PE=3 SV=1 55 557 3.0E-89
sp|O58734|SYP_PYRHO Proline--tRNA ligase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=proS PE=3 SV=2 55 557 1.0E-88
sp|Q979Q5|SYP_THEVO Proline--tRNA ligase OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=proS PE=3 SV=1 53 498 2.0E-87
sp|Q2W136|SYP_MAGSA Proline--tRNA ligase OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=proS PE=3 SV=2 49 532 3.0E-87
sp|Q2NAH8|SYP_ERYLH Proline--tRNA ligase OS=Erythrobacter litoralis (strain HTCC2594) GN=proS PE=3 SV=1 49 452 4.0E-86
sp|B2UL92|SYP_AKKM8 Proline--tRNA ligase OS=Akkermansia muciniphila (strain ATCC BAA-835 / Muc) GN=proS PE=3 SV=1 49 458 8.0E-86
sp|Q7UGJ7|SYP_RHOBA Proline--tRNA ligase OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=proS PE=3 SV=1 49 499 6.0E-84
sp|B5ZBT9|SYP_UREU1 Proline--tRNA ligase OS=Ureaplasma urealyticum serovar 10 (strain ATCC 33699 / Western) GN=proS PE=3 SV=1 52 557 2.0E-83
sp|Q12ZC6|SYP_METBU Proline--tRNA ligase OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=proS PE=3 SV=1 51 488 2.0E-83
sp|A2ST96|SYP_METLZ Proline--tRNA ligase OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=proS PE=3 SV=1 57 539 4.0E-82
sp|Q6KZA3|SYP_PICTO Proline--tRNA ligase OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=proS PE=3 SV=1 53 494 7.0E-82
sp|Q9HJN0|SYP_THEAC Proline--tRNA ligase OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=proS PE=3 SV=1 53 498 3.0E-81
sp|A8MC04|SYP_CALMQ Proline--tRNA ligase OS=Caldivirga maquilingensis (strain ATCC 700844 / DSM 13496 / JCM 10307 / IC-167) GN=proS PE=3 SV=1 57 557 3.0E-81
sp|A8A9E3|SYP_IGNH4 Proline--tRNA ligase OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=proS PE=3 SV=1 50 557 5.0E-81
sp|Q9PQ38|SYP_UREPA Proline--tRNA ligase OS=Ureaplasma parvum serovar 3 (strain ATCC 700970) GN=proS PE=3 SV=1 53 557 7.0E-81
sp|B1AJ93|SYP_UREP2 Proline--tRNA ligase OS=Ureaplasma parvum serovar 3 (strain ATCC 27815 / 27 / NCTC 11736) GN=proS PE=3 SV=1 53 557 7.0E-81
sp|Q7X2P1|SYP_SPHEL Proline--tRNA ligase OS=Sphingomonas elodea GN=proS PE=3 SV=1 49 458 3.0E-80
sp|Q1GTS7|SYP_SPHAL Proline--tRNA ligase OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=proS PE=3 SV=1 49 458 9.0E-80
sp|A6VK03|SYP_METM7 Proline--tRNA ligase OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=proS PE=3 SV=1 58 482 2.0E-79
sp|Q6LZD3|SYP_METMP Proline--tRNA ligase OS=Methanococcus maripaludis (strain S2 / LL) GN=proS PE=3 SV=1 58 482 5.0E-79
sp|A7I9R7|SYP_METB6 Proline--tRNA ligase OS=Methanoregula boonei (strain 6A8) GN=proS PE=3 SV=1 54 494 9.0E-79
sp|Q9Y9G0|SYP_AERPE Proline--tRNA ligase OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=proS PE=3 SV=1 55 557 1.0E-78
sp|Q8EUW7|SYP_MYCPE Proline--tRNA ligase OS=Mycoplasma penetrans (strain HF-2) GN=proS PE=3 SV=1 52 497 2.0E-78
sp|A4FYA4|SYP_METM5 Proline--tRNA ligase OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=proS PE=3 SV=1 58 482 1.0E-77
sp|Q2G6Y3|SYP_NOVAD Proline--tRNA ligase OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=proS PE=3 SV=1 49 453 1.0E-77
sp|Q2FLY5|SYP_METHJ Proline--tRNA ligase OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=proS PE=3 SV=1 51 495 3.0E-77
sp|A9A787|SYP_METM6 Proline--tRNA ligase OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=proS PE=3 SV=1 58 482 3.0E-77
sp|B1Y963|SYP_PYRNV Proline--tRNA ligase OS=Pyrobaculum neutrophilum (strain DSM 2338 / JCM 9278 / V24Sta) GN=proS PE=3 SV=1 54 557 5.0E-77
sp|A1RSR6|SYP_PYRIL Proline--tRNA ligase OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=proS PE=3 SV=1 57 557 6.0E-77
sp|Q8TW09|SYP_METKA Proline--tRNA ligase OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=proS PE=3 SV=1 57 494 8.0E-77
sp|A6USJ4|SYP_METVS Proline--tRNA ligase OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=proS PE=3 SV=1 58 483 2.0E-76
sp|Q0W0C9|SYP_METAR Proline--tRNA ligase OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=proS PE=3 SV=1 51 451 2.0E-76
sp|A5UJW4|SYP_METS3 Proline--tRNA ligase OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=proS PE=3 SV=1 56 496 5.0E-76
sp|Q58635|SYP_METJA Proline--tRNA ligase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=proS PE=1 SV=1 58 482 2.0E-75
sp|O26708|SYP_METTH Proline--tRNA ligase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=proS PE=1 SV=1 54 451 2.0E-75
sp|A3MV50|SYP_PYRCJ Proline--tRNA ligase OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=proS PE=3 SV=1 55 557 2.0E-75
sp|A4YI09|SYP_METS5 Proline--tRNA ligase OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=proS PE=3 SV=1 55 536 3.0E-75
sp|Q8ZVQ9|SYP_PYRAE Proline--tRNA ligase OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=proS PE=3 SV=1 57 557 5.0E-75
sp|Q971B5|SYP_SULTO Proline--tRNA ligase OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=proS PE=3 SV=1 57 505 1.0E-74
sp|A0B9N3|SYP_METTP Proline--tRNA ligase OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=proS PE=3 SV=1 57 488 2.0E-74
sp|A3CX68|SYP_METMJ Proline--tRNA ligase OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=proS PE=3 SV=1 54 447 1.0E-73
sp|Q2NFL1|SYP_METST Proline--tRNA ligase OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=proS PE=3 SV=1 57 494 1.0E-73
sp|Q4J8L4|SYP_SULAC Proline--tRNA ligase OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=proS PE=3 SV=1 56 536 1.0E-73
sp|O28664|SYP_ARCFU Proline--tRNA ligase OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=proS PE=3 SV=2 50 504 2.0E-73
sp|Q7NBP5|SYP_MYCGA Proline--tRNA ligase OS=Mycoplasma gallisepticum (strain R(low / passage 15 / clone 2)) GN=proS PE=3 SV=1 49 557 2.0E-73
sp|A4WJ22|SYP_PYRAR Proline--tRNA ligase OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=proS PE=3 SV=1 57 496 3.0E-73
sp|C3MW88|SYP_SULIM Proline--tRNA ligase OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=proS PE=3 SV=1 57 497 2.0E-72
sp|C3N6D0|SYP_SULIA Proline--tRNA ligase OS=Sulfolobus islandicus (strain M.16.27) GN=proS PE=3 SV=1 57 497 2.0E-72
sp|A6UTK4|SYP_META3 Proline--tRNA ligase OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=proS PE=3 SV=1 56 482 2.0E-72
sp|C3NET8|SYP_SULIY Proline--tRNA ligase OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=proS PE=3 SV=1 57 497 3.0E-72
sp|C3NGV6|SYP_SULIN Proline--tRNA ligase OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=proS PE=3 SV=1 57 497 3.0E-72
sp|C3MQL0|SYP_SULIL Proline--tRNA ligase OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=proS PE=3 SV=1 57 497 3.0E-72
sp|C4KHU5|SYP_SULIK Proline--tRNA ligase OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=proS PE=3 SV=1 57 497 1.0E-71
sp|Q9UWX2|SYP_SULSO Proline--tRNA ligase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=proS PE=3 SV=1 57 497 1.0E-71
sp|P75382|SYP_MYCPN Proline--tRNA ligase OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=proS PE=3 SV=1 53 494 2.0E-53
sp|P47525|SYP_MYCGE Proline--tRNA ligase OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=proS PE=3 SV=1 54 493 2.0E-49
sp|Q74ND5|SYP_NANEQ Proline--tRNA ligase OS=Nanoarchaeum equitans (strain Kin4-M) GN=proS PE=3 SV=1 52 293 1.0E-45
sp|Q74ND5|SYP_NANEQ Proline--tRNA ligase OS=Nanoarchaeum equitans (strain Kin4-M) GN=proS PE=3 SV=1 302 557 6.0E-23
sp|Q2K9R4|SYP_RHIEC Proline--tRNA ligase OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=proS PE=3 SV=2 63 429 4.0E-16
sp|Q0BSM0|SYP_GRABC Proline--tRNA ligase OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=proS PE=3 SV=2 63 438 4.0E-16
sp|Q5FUU9|SYP_GLUOX Proline--tRNA ligase OS=Gluconobacter oxydans (strain 621H) GN=proS PE=3 SV=1 63 436 1.0E-14
sp|Q1MIJ6|SYP_RHIL3 Proline--tRNA ligase OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=proS PE=3 SV=1 63 429 1.0E-14
sp|A8EZ51|SYP_RICCK Proline--tRNA ligase OS=Rickettsia canadensis (strain McKiel) GN=proS PE=3 SV=1 63 432 1.0E-14
sp|B3PW17|SYP_RHIE6 Proline--tRNA ligase OS=Rhizobium etli (strain CIAT 652) GN=proS PE=3 SV=1 63 429 2.0E-14
sp|A9W1L5|SYP_METEP Proline--tRNA ligase OS=Methylobacterium extorquens (strain PA1) GN=proS PE=3 SV=1 63 439 3.0E-14
sp|B7KPK1|SYP_METC4 Proline--tRNA ligase OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=proS PE=3 SV=1 63 439 3.0E-14
sp|B5ZYN2|SYP_RHILW Proline--tRNA ligase OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=proS PE=3 SV=1 63 429 3.0E-14
sp|Q2RU19|SYP_RHORT Proline--tRNA ligase OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=proS PE=3 SV=1 63 436 7.0E-14
sp|B8IUW4|SYP_METNO Proline--tRNA ligase OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=proS PE=3 SV=1 63 436 9.0E-14
sp|Q168E6|SYP_ROSDO Proline--tRNA ligase OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=proS PE=3 SV=1 63 428 3.0E-13
sp|B1LUL8|SYP_METRJ Proline--tRNA ligase OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=proS PE=3 SV=1 63 436 4.0E-13
sp|A5V8U0|SYP_SPHWW Proline--tRNA ligase OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=proS PE=3 SV=1 63 436 8.0E-13
sp|Q0AB94|SYP_ALKEH Proline--tRNA ligase OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=proS PE=3 SV=1 269 440 9.0E-13
sp|B1ZA28|SYP_METPB Proline--tRNA ligase OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=proS PE=3 SV=1 63 436 9.0E-13
sp|Q1RIC9|SYP_RICBR Proline--tRNA ligase OS=Rickettsia bellii (strain RML369-C) GN=proS PE=3 SV=1 63 423 1.0E-12
sp|A8GU77|SYP_RICB8 Proline--tRNA ligase OS=Rickettsia bellii (strain OSU 85-389) GN=proS PE=3 SV=1 63 423 1.0E-12
sp|B3Q7L2|SYP_RHOPT Proline--tRNA ligase OS=Rhodopseudomonas palustris (strain TIE-1) GN=proS PE=3 SV=1 63 436 2.0E-12
sp|A1K976|SYP_AZOSB Proline--tRNA ligase OS=Azoarcus sp. (strain BH72) GN=proS PE=3 SV=1 269 444 2.0E-12
sp|B3R4J1|SYT_CUPTR Threonine--tRNA ligase OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=thrS PE=3 SV=1 70 451 3.0E-12
sp|Q73GW6|SYP_WOLPM Proline--tRNA ligase OS=Wolbachia pipientis wMel GN=proS PE=3 SV=1 67 423 1.0E-11
sp|B2JHD3|SYP_BURP8 Proline--tRNA ligase OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=proS PE=3 SV=1 269 429 2.0E-11
sp|C4XTD0|SYP_DESMR Proline--tRNA ligase OS=Desulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1) GN=proS PE=3 SV=1 269 429 2.0E-11
sp|C4LBX6|SYP_TOLAT Proline--tRNA ligase OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=proS PE=3 SV=1 269 436 3.0E-11
sp|C6E496|SYP_GEOSM Proline--tRNA ligase OS=Geobacter sp. (strain M21) GN=proS PE=3 SV=1 269 436 3.0E-11
sp|Q11JI8|SYP_CHESB Proline--tRNA ligase OS=Chelativorans sp. (strain BNC1) GN=proS PE=3 SV=1 63 432 3.0E-11
sp|Q2KVA0|SYP_BORA1 Proline--tRNA ligase OS=Bordetella avium (strain 197N) GN=proS PE=3 SV=1 269 421 3.0E-11
sp|Q472N7|SYT_CUPPJ Threonine--tRNA ligase OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=thrS PE=3 SV=1 70 451 4.0E-11
sp|B0RZJ0|SYP_FINM2 Proline--tRNA ligase OS=Finegoldia magna (strain ATCC 29328) GN=proS PE=3 SV=1 269 442 4.0E-11
sp|B0ULM2|SYP_METS4 Proline--tRNA ligase OS=Methylobacterium sp. (strain 4-46) GN=proS PE=3 SV=1 63 436 4.0E-11
sp|B5EIT9|SYP_GEOBB Proline--tRNA ligase OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=proS PE=3 SV=1 269 436 5.0E-11
sp|B0SM58|SYP_LEPBP Proline--tRNA ligase OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris) GN=proS PE=3 SV=1 269 447 5.0E-11
sp|B0SDM9|SYP_LEPBA Proline--tRNA ligase OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames) GN=proS PE=3 SV=1 269 447 5.0E-11
sp|Q7WFN9|SYP_BORBR Proline--tRNA ligase OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=proS PE=3 SV=1 269 429 5.0E-11
sp|Q7VTZ8|SYP_BORPE Proline--tRNA ligase OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=proS PE=3 SV=1 269 429 5.0E-11
sp|Q7W481|SYP_BORPA Proline--tRNA ligase OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=proS PE=3 SV=1 269 429 6.0E-11
sp|B3R894|SYP_CUPTR Proline--tRNA ligase OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=proS PE=3 SV=1 269 440 6.0E-11
sp|A3QG64|SYP_SHELP Proline--tRNA ligase OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=proS PE=3 SV=1 269 432 9.0E-11
sp|Q0KBZ3|SYT_CUPNH Threonine--tRNA ligase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=thrS PE=3 SV=1 70 451 9.0E-11
sp|A4TL66|SYP_YERPP Proline--tRNA ligase OS=Yersinia pestis (strain Pestoides F) GN=proS PE=3 SV=1 228 432 1.0E-10
sp|Q1CFH2|SYP_YERPN Proline--tRNA ligase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=proS PE=3 SV=1 228 432 1.0E-10
sp|A9R371|SYP_YERPG Proline--tRNA ligase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=proS PE=3 SV=1 228 432 1.0E-10
sp|Q7CH25|SYP_YERPE Proline--tRNA ligase OS=Yersinia pestis GN=proS PE=3 SV=1 228 432 1.0E-10
sp|Q1CAK9|SYP_YERPA Proline--tRNA ligase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=proS PE=3 SV=1 228 432 1.0E-10
sp|A9AI56|SYP_BURM1 Proline--tRNA ligase OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=proS PE=3 SV=1 269 438 1.0E-10
sp|A1RI33|SYP_SHESW Proline--tRNA ligase OS=Shewanella sp. (strain W3-18-1) GN=proS PE=3 SV=1 266 429 1.0E-10
sp|Q12L53|SYP_SHEDO Proline--tRNA ligase OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=proS PE=3 SV=1 266 432 1.0E-10
sp|A4Y8F6|SYP_SHEPC Proline--tRNA ligase OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=proS PE=3 SV=1 266 429 1.0E-10
sp|B2SYU8|SYP_BURPP Proline--tRNA ligase OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=proS PE=3 SV=1 269 429 1.0E-10
sp|Q15WD6|SYP_PSEA6 Proline--tRNA ligase OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=proS PE=3 SV=1 269 439 1.0E-10
sp|A1W4B3|SYP_ACISJ Proline--tRNA ligase OS=Acidovorax sp. (strain JS42) GN=proS PE=3 SV=1 269 440 2.0E-10
sp|B9ME00|SYP_ACIET Proline--tRNA ligase OS=Acidovorax ebreus (strain TPSY) GN=proS PE=3 SV=1 269 440 2.0E-10
sp|Q5WT82|SYT_LEGPL Threonine--tRNA ligase OS=Legionella pneumophila (strain Lens) GN=thrS PE=3 SV=1 74 429 2.0E-10
sp|Q667L4|SYP_YERPS Proline--tRNA ligase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=proS PE=3 SV=1 228 432 2.0E-10
sp|B2JZ09|SYP_YERPB Proline--tRNA ligase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=proS PE=3 SV=1 228 432 2.0E-10
sp|Q0HKJ4|SYP_SHESM Proline--tRNA ligase OS=Shewanella sp. (strain MR-4) GN=proS PE=3 SV=1 266 432 2.0E-10
sp|B8EDD0|SYP_SHEB2 Proline--tRNA ligase OS=Shewanella baltica (strain OS223) GN=proS PE=3 SV=1 266 428 2.0E-10
sp|Q0HWU6|SYP_SHESR Proline--tRNA ligase OS=Shewanella sp. (strain MR-7) GN=proS PE=3 SV=1 266 432 2.0E-10
sp|B1JQI5|SYP_YERPY Proline--tRNA ligase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=proS PE=3 SV=1 228 432 2.0E-10
sp|A7FFJ4|SYP_YERP3 Proline--tRNA ligase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=proS PE=3 SV=1 228 432 2.0E-10
sp|Q5ZS05|SYT_LEGPH Threonine--tRNA ligase OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=thrS PE=3 SV=2 74 429 2.0E-10
sp|A6WQB8|SYP_SHEB8 Proline--tRNA ligase OS=Shewanella baltica (strain OS185) GN=proS PE=3 SV=1 266 428 2.0E-10
sp|Q891T0|SYT_CLOTE Threonine--tRNA ligase OS=Clostridium tetani (strain Massachusetts / E88) GN=thrS PE=3 SV=1 70 436 2.0E-10
sp|Q8ECI8|SYP_SHEON Proline--tRNA ligase OS=Shewanella oneidensis (strain MR-1) GN=proS PE=3 SV=1 266 432 2.0E-10
sp|A3D6H7|SYP_SHEB5 Proline--tRNA ligase OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=proS PE=3 SV=1 266 428 2.0E-10
sp|A9KVR8|SYP_SHEB9 Proline--tRNA ligase OS=Shewanella baltica (strain OS195) GN=proS PE=3 SV=1 266 428 2.0E-10
sp|Q0BIH4|SYP_BURCM Proline--tRNA ligase OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=proS PE=3 SV=1 269 438 2.0E-10
sp|A5IAK9|SYT_LEGPC Threonine--tRNA ligase OS=Legionella pneumophila (strain Corby) GN=thrS PE=3 SV=1 74 429 2.0E-10
sp|Q13U19|SYP_BURXL Proline--tRNA ligase OS=Burkholderia xenovorans (strain LB400) GN=proS PE=3 SV=1 269 429 2.0E-10
sp|A4JBC2|SYP_BURVG Proline--tRNA ligase OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=proS PE=3 SV=1 269 438 2.0E-10
sp|A9I4I5|SYP_BORPD Proline--tRNA ligase OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=proS PE=3 SV=1 269 443 3.0E-10
sp|Q31GQ3|SYP_THICR Proline--tRNA ligase OS=Thiomicrospira crunogena (strain XCL-2) GN=proS PE=3 SV=1 269 430 3.0E-10
sp|Q0ADN4|SYT_NITEC Threonine--tRNA ligase OS=Nitrosomonas eutropha (strain C91) GN=thrS PE=3 SV=1 68 429 3.0E-10
sp|B1YSV1|SYP_BURA4 Proline--tRNA ligase OS=Burkholderia ambifaria (strain MC40-6) GN=proS PE=3 SV=1 269 438 3.0E-10
sp|Q5X1H3|SYT_LEGPA Threonine--tRNA ligase OS=Legionella pneumophila (strain Paris) GN=thrS PE=3 SV=1 74 429 4.0E-10
sp|Q6LN48|SYP_PHOPR Proline--tRNA ligase OS=Photobacterium profundum GN=proS PE=3 SV=1 269 432 4.0E-10
sp|Q5P7T1|SYP_AROAE Proline--tRNA ligase OS=Aromatoleum aromaticum (strain EbN1) GN=proS PE=3 SV=1 269 436 5.0E-10
sp|Q46X21|SYP_CUPPJ Proline--tRNA ligase OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=proS PE=3 SV=1 269 432 5.0E-10
sp|A5I6L8|SYT_CLOBH Threonine--tRNA ligase OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=thrS PE=3 SV=1 70 451 5.0E-10
sp|A7FY87|SYT_CLOB1 Threonine--tRNA ligase OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=thrS PE=3 SV=1 70 451 5.0E-10
sp|A0KV13|SYP_SHESA Proline--tRNA ligase OS=Shewanella sp. (strain ANA-3) GN=proS PE=3 SV=1 266 432 6.0E-10
sp|B4E5W6|SYP_BURCJ Proline--tRNA ligase OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=proS PE=3 SV=1 269 438 7.0E-10
sp|A3NDS2|SYP_BURP6 Proline--tRNA ligase OS=Burkholderia pseudomallei (strain 668) GN=proS PE=3 SV=1 269 428 7.0E-10
sp|Q2SZF6|SYP_BURTA Proline--tRNA ligase OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=proS PE=3 SV=1 269 438 7.0E-10
sp|Q0K6Q0|SYP_CUPNH Proline--tRNA ligase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=proS PE=3 SV=1 269 432 7.0E-10
sp|B2UCU9|SYP_RALPJ Proline--tRNA ligase OS=Ralstonia pickettii (strain 12J) GN=proS PE=3 SV=1 269 428 8.0E-10
sp|Q63QM5|SYP_BURPS Proline--tRNA ligase OS=Burkholderia pseudomallei (strain K96243) GN=proS PE=3 SV=1 269 428 8.0E-10
sp|Q3JNG4|SYP_BURP1 Proline--tRNA ligase OS=Burkholderia pseudomallei (strain 1710b) GN=proS PE=3 SV=1 269 428 8.0E-10
sp|A3NZI6|SYP_BURP0 Proline--tRNA ligase OS=Burkholderia pseudomallei (strain 1106a) GN=proS PE=3 SV=1 269 428 8.0E-10
sp|A1V0N6|SYP_BURMS Proline--tRNA ligase OS=Burkholderia mallei (strain SAVP1) GN=proS PE=3 SV=1 269 428 8.0E-10
sp|A2S5R3|SYP_BURM9 Proline--tRNA ligase OS=Burkholderia mallei (strain NCTC 10229) GN=proS PE=3 SV=1 269 428 8.0E-10
sp|A3MR95|SYP_BURM7 Proline--tRNA ligase OS=Burkholderia mallei (strain NCTC 10247) GN=proS PE=3 SV=1 269 428 8.0E-10
sp|Q62GV8|SYP_BURMA Proline--tRNA ligase OS=Burkholderia mallei (strain ATCC 23344) GN=proS PE=3 SV=1 269 428 8.0E-10
sp|A4J5Y2|SYP_DESRM Proline--tRNA ligase OS=Desulfotomaculum reducens (strain MI-1) GN=proS PE=3 SV=1 268 443 8.0E-10
sp|B0TNJ5|SYP_SHEHH Proline--tRNA ligase OS=Shewanella halifaxensis (strain HAW-EB4) GN=proS PE=3 SV=1 269 432 8.0E-10
sp|A8H6J5|SYP_SHEPA Proline--tRNA ligase OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=proS PE=3 SV=1 269 432 9.0E-10
sp|A1S4R2|SYP_SHEAM Proline--tRNA ligase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=proS PE=3 SV=1 238 432 9.0E-10
sp|P56881|SYT_THET8 Threonine--tRNA ligase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=thrS PE=1 SV=1 165 430 1.0E-09
sp|C1FKN0|SYT_CLOBJ Threonine--tRNA ligase OS=Clostridium botulinum (strain Kyoto / Type A2) GN=thrS PE=3 SV=1 70 451 1.0E-09
sp|B1XYW5|SYP_LEPCP Proline--tRNA ligase OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=proS PE=3 SV=1 264 442 1.0E-09
sp|Q0VRL1|SYP_ALCBS Proline--tRNA ligase OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=proS PE=3 SV=2 269 438 1.0E-09
sp|B8J9M0|SYP_ANAD2 Proline--tRNA ligase OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=proS PE=3 SV=1 279 438 1.0E-09
sp|A6T2D1|SYP_JANMA Proline--tRNA ligase OS=Janthinobacterium sp. (strain Marseille) GN=proS PE=3 SV=1 269 421 1.0E-09
sp|Q07ZH1|SYP_SHEFN Proline--tRNA ligase OS=Shewanella frigidimarina (strain NCIMB 400) GN=proS PE=3 SV=1 266 434 1.0E-09
sp|B4UGI0|SYP_ANASK Proline--tRNA ligase OS=Anaeromyxobacter sp. (strain K) GN=proS PE=3 SV=1 279 438 1.0E-09
sp|Q3JCN7|SYP_NITOC Proline--tRNA ligase OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=proS PE=3 SV=1 268 429 1.0E-09
sp|B4F249|SYP_PROMH Proline--tRNA ligase OS=Proteus mirabilis (strain HI4320) GN=proS PE=3 SV=1 63 235 1.0E-09
sp|B1HQZ9|SYP_LYSSC Proline--tRNA ligase OS=Lysinibacillus sphaericus (strain C3-41) GN=proS PE=3 SV=1 66 235 1.0E-09
sp|Q1BZD6|SYP_BURCA Proline--tRNA ligase OS=Burkholderia cenocepacia (strain AU 1054) GN=proS PE=3 SV=1 269 428 1.0E-09
sp|A7GI05|SYT_CLOBL Threonine--tRNA ligase OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=thrS PE=3 SV=1 70 451 1.0E-09
sp|B8DTM3|SYP_BIFA0 Proline--tRNA ligase OS=Bifidobacterium animalis subsp. lactis (strain AD011) GN=proS PE=3 SV=1 269 429 2.0E-09
sp|A0K4B4|SYP_BURCH Proline--tRNA ligase OS=Burkholderia cenocepacia (strain HI2424) GN=proS PE=3 SV=1 269 428 2.0E-09
sp|B1JVA5|SYP_BURCC Proline--tRNA ligase OS=Burkholderia cenocepacia (strain MC0-3) GN=proS PE=3 SV=1 269 428 2.0E-09
sp|A4SVA7|SYP_POLSQ Proline--tRNA ligase OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=proS PE=3 SV=1 269 436 2.0E-09
sp|Q03QS8|SYP_LACBA Proline--tRNA ligase OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=proS PE=3 SV=1 269 443 2.0E-09
sp|B9JFG4|SYT_AGRRK Threonine--tRNA ligase OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=thrS PE=3 SV=1 70 457 2.0E-09
sp|C3KTK0|SYT_CLOB6 Threonine--tRNA ligase OS=Clostridium botulinum (strain 657 / Type Ba4) GN=thrS PE=3 SV=1 70 451 2.0E-09
sp|Q5QW31|SYP_IDILO Proline--tRNA ligase OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=proS PE=3 SV=1 268 429 2.0E-09
sp|Q39JU3|SYP_BURL3 Proline--tRNA ligase OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=proS PE=3 SV=1 269 428 2.0E-09
sp|Q2SD07|SYP_HAHCH Proline--tRNA ligase OS=Hahella chejuensis (strain KCTC 2396) GN=proS PE=3 SV=1 258 421 2.0E-09
sp|Q7NYC6|SYT_CHRVO Threonine--tRNA ligase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=thrS PE=3 SV=1 62 438 2.0E-09
sp|A9B562|SYP_HERA2 Proline--tRNA ligase OS=Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785) GN=proS PE=3 SV=1 269 432 2.0E-09
sp|B1L0T7|SYT_CLOBM Threonine--tRNA ligase OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=thrS PE=3 SV=1 70 451 3.0E-09
sp|Q72HH1|SYT_THET2 Threonine--tRNA ligase OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=thrS PE=3 SV=1 165 430 3.0E-09
sp|A5FX26|SYP_ACICJ Proline--tRNA ligase OS=Acidiphilium cryptum (strain JF-5) GN=proS PE=3 SV=1 268 436 3.0E-09
sp|Q2GK70|SYP_ANAPZ Proline--tRNA ligase OS=Anaplasma phagocytophilum (strain HZ) GN=proS PE=3 SV=1 76 436 3.0E-09
sp|Q7P0J3|SYP_CHRVO Proline--tRNA ligase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=proS PE=3 SV=1 269 421 3.0E-09
sp|A1A0K4|SYP_BIFAA Proline--tRNA ligase OS=Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a) GN=proS PE=3 SV=1 269 429 4.0E-09
sp|A4G8R0|SYP_HERAR Proline--tRNA ligase OS=Herminiimonas arsenicoxydans GN=proS PE=3 SV=1 264 421 4.0E-09
sp|Q82VV1|SYT_NITEU Threonine--tRNA ligase OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=thrS PE=3 SV=1 68 429 4.0E-09
sp|A6Q7Y7|SYP_SULNB Proline--tRNA ligase OS=Sulfurovum sp. (strain NBC37-1) GN=proS PE=3 SV=1 79 235 4.0E-09
sp|B0TY89|SYT_FRAP2 Threonine--tRNA ligase OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=thrS PE=3 SV=1 70 442 4.0E-09
sp|Q6D1B9|SYP_PECAS Proline--tRNA ligase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=proS PE=3 SV=1 258 432 4.0E-09
sp|A1S4R2|SYP_SHEAM Proline--tRNA ligase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=proS PE=3 SV=1 63 235 5.0E-09
sp|Q7N8M7|SYP_PHOLL Proline--tRNA ligase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=proS PE=3 SV=1 63 235 5.0E-09
sp|B0K5F2|SYP_THEPX Proline--tRNA ligase OS=Thermoanaerobacter sp. (strain X514) GN=proS PE=3 SV=1 269 441 5.0E-09
sp|Q2RNL4|SYT_RHORT Threonine--tRNA ligase OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=thrS PE=3 SV=1 62 440 5.0E-09
sp|B0KCH5|SYP_THEP3 Proline--tRNA ligase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=proS PE=3 SV=1 269 441 5.0E-09
sp|Q2IGK6|SYP1_ANADE Proline--tRNA ligase 1 OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=proS1 PE=3 SV=1 279 438 5.0E-09
sp|B4RBZ9|SYP_PHEZH Proline--tRNA ligase OS=Phenylobacterium zucineum (strain HLK1) GN=proS PE=3 SV=1 267 429 5.0E-09
sp|Q2LTR7|SYP_SYNAS Proline--tRNA ligase OS=Syntrophus aciditrophicus (strain SB) GN=proS PE=3 SV=2 268 448 5.0E-09
sp|B1KNR3|SYP_SHEWM Proline--tRNA ligase OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=proS PE=3 SV=1 269 432 6.0E-09
sp|Q9PHX1|SYP_CAMJE Proline--tRNA ligase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=proS PE=3 SV=1 79 236 6.0E-09
sp|Q47Z50|SYP_COLP3 Proline--tRNA ligase OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=proS PE=3 SV=1 57 235 6.0E-09
sp|C3LTC5|SYP_VIBCM Proline--tRNA ligase OS=Vibrio cholerae serotype O1 (strain M66-2) GN=proS PE=3 SV=1 269 432 6.0E-09
sp|Q9KTM7|SYP_VIBCH Proline--tRNA ligase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=proS PE=3 SV=1 269 432 6.0E-09
sp|A5F340|SYP_VIBC3 Proline--tRNA ligase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=proS PE=3 SV=1 269 432 6.0E-09
sp|A7H4J9|SYP_CAMJD Proline--tRNA ligase OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=proS PE=3 SV=1 79 236 6.0E-09
sp|A0KPA5|SYP_AERHH Proline--tRNA ligase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=proS PE=3 SV=1 269 434 6.0E-09
sp|B1XT38|SYP_POLNS Proline--tRNA ligase OS=Polynucleobacter necessarius subsp. necessarius (strain STIR1) GN=proS PE=3 SV=1 269 447 7.0E-09
sp|Q5HVM3|SYP_CAMJR Proline--tRNA ligase OS=Campylobacter jejuni (strain RM1221) GN=proS PE=3 SV=1 79 236 7.0E-09
sp|B1IMV3|SYT_CLOBK Threonine--tRNA ligase OS=Clostridium botulinum (strain Okra / Type B1) GN=thrS PE=3 SV=1 70 454 7.0E-09
sp|Q1LIQ4|SYP_CUPMC Proline--tRNA ligase OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=proS PE=3 SV=2 269 421 7.0E-09
sp|Q0TMM3|SYP_CLOP1 Proline--tRNA ligase OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=proS PE=3 SV=1 216 441 7.0E-09
sp|Q6FE23|SYP_ACIAD Proline--tRNA ligase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=proS PE=3 SV=1 269 423 7.0E-09
sp|Q8XHQ4|SYP_CLOPE Proline--tRNA ligase OS=Clostridium perfringens (strain 13 / Type A) GN=proS PE=3 SV=1 216 441 8.0E-09
sp|Q47ID0|SYP_DECAR Proline--tRNA ligase OS=Dechloromonas aromatica (strain RCB) GN=proS PE=3 SV=1 269 423 8.0E-09
sp|Q8YH89|SYT_BRUME Threonine--tRNA ligase OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=thrS PE=3 SV=1 70 438 9.0E-09
sp|B4F249|SYP_PROMH Proline--tRNA ligase OS=Proteus mirabilis (strain HI4320) GN=proS PE=3 SV=1 269 440 1.0E-08
sp|B1KNR3|SYP_SHEWM Proline--tRNA ligase OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=proS PE=3 SV=1 63 235 1.0E-08
sp|C5B780|SYP_EDWI9 Proline--tRNA ligase OS=Edwardsiella ictaluri (strain 93-146) GN=proS PE=3 SV=1 63 235 1.0E-08
sp|F8DT95|SYP_ZYMMA Proline--tRNA ligase OS=Zymomonas mobilis subsp. mobilis (strain ATCC 10988 / DSM 424 / LMG 404 / NCIMB 8938 / NRRL B-806 / ZM1) GN=proS PE=3 SV=1 269 429 1.0E-08
sp|A2SD40|SYP_METPP Proline--tRNA ligase OS=Methylibium petroleiphilum (strain PM1) GN=proS PE=3 SV=1 269 436 1.0E-08
sp|C6DDF6|SYP_PECCP Proline--tRNA ligase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=proS PE=3 SV=1 258 427 1.0E-08
sp|A1VYQ2|SYP_CAMJJ Proline--tRNA ligase OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=proS PE=3 SV=1 79 236 1.0E-08
sp|A0Q762|SYT_FRATN Threonine--tRNA ligase OS=Francisella tularensis subsp. novicida (strain U112) GN=thrS PE=3 SV=1 70 423 1.0E-08
sp|Q9CL72|SYP_PASMU Proline--tRNA ligase OS=Pasteurella multocida (strain Pm70) GN=proS PE=3 SV=1 269 427 1.0E-08
sp|A8FKW6|SYP_CAMJ8 Proline--tRNA ligase OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=proS PE=3 SV=1 79 236 1.0E-08
sp|A6VXT1|SYP_MARMS Proline--tRNA ligase OS=Marinomonas sp. (strain MWYL1) GN=proS PE=3 SV=1 269 430 1.0E-08
sp|P0DJA8|SYP_ZYMMO Proline--tRNA ligase OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=proS PE=3 SV=1 269 429 1.0E-08
sp|A8H6J5|SYP_SHEPA Proline--tRNA ligase OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=proS PE=3 SV=1 63 235 2.0E-08
sp|B2A5P2|SYT_NATTJ Threonine--tRNA ligase OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=thrS PE=3 SV=1 70 432 2.0E-08
sp|B0THP0|SYP_HELMI Proline--tRNA ligase OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=proS PE=3 SV=1 268 440 2.0E-08
sp|A6TL31|SYP_ALKMQ Proline--tRNA ligase OS=Alkaliphilus metalliredigens (strain QYMF) GN=proS PE=3 SV=1 269 432 2.0E-08
sp|Q038L9|SYP_LACC3 Proline--tRNA ligase OS=Lactobacillus casei (strain ATCC 334) GN=proS PE=3 SV=1 244 423 2.0E-08
sp|B1H063|SYP_UNCTG Proline--tRNA ligase OS=Uncultured termite group 1 bacterium phylotype Rs-D17 GN=proS PE=3 SV=1 79 214 2.0E-08
sp|A6VKR5|SYP_ACTSZ Proline--tRNA ligase OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=proS PE=3 SV=1 63 235 2.0E-08
sp|Q98LR2|SYT_RHILO Threonine--tRNA ligase OS=Rhizobium loti (strain MAFF303099) GN=thrS PE=3 SV=1 70 438 2.0E-08
sp|Q8XVL4|SYP_RALSO Proline--tRNA ligase OS=Ralstonia solanacearum (strain GMI1000) GN=proS PE=3 SV=1 269 420 2.0E-08
sp|B3GZ82|SYP_ACTP7 Proline--tRNA ligase OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=proS PE=3 SV=1 269 427 2.0E-08
sp|A4SJ23|SYP_AERS4 Proline--tRNA ligase OS=Aeromonas salmonicida (strain A449) GN=proS PE=3 SV=1 269 434 2.0E-08
sp|A9MPG5|SYP_SALAR Proline--tRNA ligase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=proS PE=3 SV=1 269 427 2.0E-08
sp|Q7CR62|SYP_SALTY Proline--tRNA ligase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=proS PE=3 SV=1 269 427 2.0E-08
sp|Q8XEY9|SYP_SALTI Proline--tRNA ligase OS=Salmonella typhi GN=proS PE=3 SV=1 269 427 2.0E-08
sp|B5BAQ2|SYP_SALPK Proline--tRNA ligase OS=Salmonella paratyphi A (strain AKU_12601) GN=proS PE=3 SV=1 269 427 2.0E-08
sp|A9N0U7|SYP_SALPB Proline--tRNA ligase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=proS PE=3 SV=1 269 427 2.0E-08
sp|Q5PD80|SYP_SALPA Proline--tRNA ligase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=proS PE=3 SV=1 269 427 2.0E-08
sp|B4SV24|SYP_SALNS Proline--tRNA ligase OS=Salmonella newport (strain SL254) GN=proS PE=3 SV=1 269 427 2.0E-08
sp|B4TK70|SYP_SALHS Proline--tRNA ligase OS=Salmonella heidelberg (strain SL476) GN=proS PE=3 SV=1 269 427 2.0E-08
sp|B5R5J8|SYP_SALG2 Proline--tRNA ligase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=proS PE=3 SV=1 269 427 2.0E-08
sp|B5R434|SYP_SALEP Proline--tRNA ligase OS=Salmonella enteritidis PT4 (strain P125109) GN=proS PE=3 SV=1 269 427 2.0E-08
sp|B5FJ42|SYP_SALDC Proline--tRNA ligase OS=Salmonella dublin (strain CT_02021853) GN=proS PE=3 SV=1 269 427 2.0E-08
sp|B5F8V6|SYP_SALA4 Proline--tRNA ligase OS=Salmonella agona (strain SL483) GN=proS PE=3 SV=1 269 427 2.0E-08
sp|Q0SQC0|SYP_CLOPS Proline--tRNA ligase OS=Clostridium perfringens (strain SM101 / Type A) GN=proS PE=3 SV=1 216 441 2.0E-08
sp|B4TYF5|SYP_SALSV Proline--tRNA ligase OS=Salmonella schwarzengrund (strain CVM19633) GN=proS PE=3 SV=1 269 427 2.0E-08
sp|Q4FNH9|SYT_PELUB Threonine--tRNA ligase OS=Pelagibacter ubique (strain HTCC1062) GN=thrS PE=3 SV=1 70 429 2.0E-08
sp|B5Y1H7|SYP_KLEP3 Proline--tRNA ligase OS=Klebsiella pneumoniae (strain 342) GN=proS PE=3 SV=1 269 427 2.0E-08
sp|C0QAP1|SYT_DESAH Threonine--tRNA ligase OS=Desulfobacterium autotrophicum (strain ATCC 43914 / DSM 3382 / HRM2) GN=thrS PE=3 SV=1 62 415 2.0E-08
sp|B0TNJ5|SYP_SHEHH Proline--tRNA ligase OS=Shewanella halifaxensis (strain HAW-EB4) GN=proS PE=3 SV=1 63 235 3.0E-08
sp|Q5QW31|SYP_IDILO Proline--tRNA ligase OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=proS PE=3 SV=1 63 235 3.0E-08
sp|Q7VKI5|SYP_HAEDU Proline--tRNA ligase OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=proS PE=3 SV=1 269 427 3.0E-08
sp|A4W6T9|SYP_ENT38 Proline--tRNA ligase OS=Enterobacter sp. (strain 638) GN=proS PE=3 SV=1 269 432 3.0E-08
sp|A1JP53|SYP_YERE8 Proline--tRNA ligase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=proS PE=3 SV=1 258 432 3.0E-08
sp|A1JP53|SYP_YERE8 Proline--tRNA ligase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=proS PE=3 SV=1 63 235 3.0E-08
sp|Q1MRD0|SYP_LAWIP Proline--tRNA ligase OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=proS PE=3 SV=1 238 429 3.0E-08
sp|B8CW65|SYP_HALOH Proline--tRNA ligase OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=proS PE=3 SV=1 270 444 3.0E-08
sp|Q6N4D3|SYT_RHOPA Threonine--tRNA ligase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=thrS PE=3 SV=1 47 428 3.0E-08
sp|Q30Z93|SYP_DESAG Proline--tRNA ligase OS=Desulfovibrio alaskensis (strain G20) GN=proS PE=3 SV=1 269 429 3.0E-08
sp|Q0BL41|SYT_FRATO Threonine--tRNA ligase OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=thrS PE=3 SV=1 70 423 3.0E-08
sp|Q8G0L8|SYT_BRUSU Threonine--tRNA ligase OS=Brucella suis biovar 1 (strain 1330) GN=thrS PE=3 SV=1 70 438 3.0E-08
sp|B0CGM0|SYT_BRUSI Threonine--tRNA ligase OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=thrS PE=3 SV=1 70 438 3.0E-08
sp|A9M582|SYT_BRUC2 Threonine--tRNA ligase OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=thrS PE=3 SV=1 70 438 3.0E-08
sp|Q2A2J0|SYT_FRATH Threonine--tRNA ligase OS=Francisella tularensis subsp. holarctica (strain LVS) GN=thrS PE=3 SV=1 70 423 3.0E-08
sp|A7NDB6|SYT_FRATF Threonine--tRNA ligase OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=thrS PE=3 SV=1 70 423 3.0E-08
sp|Q57D65|SYT_BRUAB Threonine--tRNA ligase OS=Brucella abortus biovar 1 (strain 9-941) GN=thrS PE=3 SV=1 70 438 3.0E-08
sp|Q2YQ07|SYT_BRUA2 Threonine--tRNA ligase OS=Brucella abortus (strain 2308) GN=thrS PE=3 SV=1 70 438 3.0E-08
sp|B2S5S6|SYT_BRUA1 Threonine--tRNA ligase OS=Brucella abortus (strain S19) GN=thrS PE=3 SV=1 70 438 3.0E-08
sp|B0BT03|SYP_ACTPJ Proline--tRNA ligase OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=proS PE=3 SV=1 269 427 3.0E-08
sp|A8GIB4|SYP_SERP5 Proline--tRNA ligase OS=Serratia proteamaculans (strain 568) GN=proS PE=3 SV=1 269 432 3.0E-08
sp|A3N3C6|SYP_ACTP2 Proline--tRNA ligase OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=proS PE=3 SV=1 269 427 4.0E-08
sp|Q0AY05|SYT_SYNWW Threonine--tRNA ligase OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=thrS PE=3 SV=1 80 426 4.0E-08
sp|A4IX68|SYT_FRATW Threonine--tRNA ligase OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=thrS PE=3 SV=1 70 423 4.0E-08
sp|Q87MC3|SYP_VIBPA Proline--tRNA ligase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=proS PE=3 SV=1 269 432 4.0E-08
sp|Q2NRN0|SYP_SODGM Proline--tRNA ligase OS=Sodalis glossinidius (strain morsitans) GN=proS PE=3 SV=1 259 432 4.0E-08
sp|A5UDZ4|SYP_HAEIE Proline--tRNA ligase OS=Haemophilus influenzae (strain PittEE) GN=proS PE=3 SV=1 79 235 4.0E-08
sp|A6T4Z7|SYP_KLEP7 Proline--tRNA ligase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=proS PE=3 SV=1 269 427 5.0E-08
sp|A7H7J7|SYP_ANADF Proline--tRNA ligase OS=Anaeromyxobacter sp. (strain Fw109-5) GN=proS PE=3 SV=1 279 438 5.0E-08
sp|A8ERT9|SYP_ARCB4 Proline--tRNA ligase OS=Arcobacter butzleri (strain RM4018) GN=proS PE=3 SV=1 76 235 5.0E-08
sp|B9LA07|SYP_NAUPA Proline--tRNA ligase OS=Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH) GN=proS PE=3 SV=1 76 235 5.0E-08
sp|A7MI22|SYP_CROS8 Proline--tRNA ligase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=proS PE=3 SV=1 63 235 5.0E-08
sp|Q0AYJ4|SYP_SYNWW Proline--tRNA ligase OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=proS PE=3 SV=1 269 443 5.0E-08
sp|A1R508|SYP_ARTAT Proline--tRNA ligase OS=Arthrobacter aurescens (strain TC1) GN=proS PE=3 SV=1 269 429 5.0E-08
sp|Q5NGL8|SYT_FRATT Threonine--tRNA ligase OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=thrS PE=3 SV=1 70 423 5.0E-08
sp|Q14I20|SYT_FRAT1 Threonine--tRNA ligase OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=thrS PE=3 SV=1 70 423 5.0E-08
sp|B7N862|SYP_ECOLU Proline--tRNA ligase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=proS PE=3 SV=1 269 427 6.0E-08
sp|B9LZK1|SYP_GEODF Proline--tRNA ligase OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=proS PE=3 SV=1 269 436 6.0E-08
sp|Q1RFZ4|SYP_ECOUT Proline--tRNA ligase OS=Escherichia coli (strain UTI89 / UPEC) GN=proS PE=3 SV=2 269 427 6.0E-08
sp|B1LGZ7|SYP_ECOSM Proline--tRNA ligase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=proS PE=3 SV=1 269 427 6.0E-08
sp|Q8FKZ4|SYP_ECOL6 Proline--tRNA ligase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=proS PE=3 SV=2 269 427 6.0E-08
sp|Q0TLD7|SYP_ECOL5 Proline--tRNA ligase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=proS PE=3 SV=1 269 427 6.0E-08
sp|A1A7N8|SYP_ECOK1 Proline--tRNA ligase OS=Escherichia coli O1:K1 / APEC GN=proS PE=3 SV=1 269 427 6.0E-08
sp|B7MP55|SYP_ECO81 Proline--tRNA ligase OS=Escherichia coli O81 (strain ED1a) GN=proS PE=3 SV=1 269 427 6.0E-08
sp|B7MBH6|SYP_ECO45 Proline--tRNA ligase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=proS PE=3 SV=1 269 427 6.0E-08
sp|B7UJ96|SYP_ECO27 Proline--tRNA ligase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=proS PE=3 SV=1 269 427 6.0E-08
sp|B7LHA4|SYP_ECO55 Proline--tRNA ligase OS=Escherichia coli (strain 55989 / EAEC) GN=proS PE=3 SV=1 269 427 6.0E-08
sp|Q3Z5G3|SYP_SHISS Proline--tRNA ligase OS=Shigella sonnei (strain Ss046) GN=proS PE=3 SV=1 269 427 6.0E-08
sp|Q83MC8|SYP_SHIFL Proline--tRNA ligase OS=Shigella flexneri GN=proS PE=3 SV=4 269 427 6.0E-08
sp|Q0T815|SYP_SHIF8 Proline--tRNA ligase OS=Shigella flexneri serotype 5b (strain 8401) GN=proS PE=3 SV=2 269 427 6.0E-08
sp|Q325U6|SYP_SHIBS Proline--tRNA ligase OS=Shigella boydii serotype 4 (strain Sb227) GN=proS PE=3 SV=1 269 427 6.0E-08
sp|B2U338|SYP_SHIB3 Proline--tRNA ligase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=proS PE=3 SV=1 269 427 6.0E-08
sp|B7LW79|SYP_ESCF3 Proline--tRNA ligase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=proS PE=3 SV=1 269 427 6.0E-08
sp|B6HZR3|SYP_ECOSE Proline--tRNA ligase OS=Escherichia coli (strain SE11) GN=proS PE=3 SV=1 269 427 6.0E-08
sp|B1IQE6|SYP_ECOLC Proline--tRNA ligase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=proS PE=3 SV=1 269 427 6.0E-08
sp|A7ZWE2|SYP_ECOHS Proline--tRNA ligase OS=Escherichia coli O9:H4 (strain HS) GN=proS PE=3 SV=1 269 427 6.0E-08
sp|B7M1Z9|SYP_ECO8A Proline--tRNA ligase OS=Escherichia coli O8 (strain IAI1) GN=proS PE=3 SV=1 269 427 6.0E-08
sp|A7ZHT6|SYP_ECO24 Proline--tRNA ligase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=proS PE=3 SV=1 269 427 6.0E-08
sp|B0SZ28|SYP_CAUSK Proline--tRNA ligase OS=Caulobacter sp. (strain K31) GN=proS PE=3 SV=1 267 436 6.0E-08
sp|B2SGS3|SYT_FRATM Threonine--tRNA ligase OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=thrS PE=3 SV=1 70 423 6.0E-08
sp|B8IZD1|SYP_DESDA Proline--tRNA ligase OS=Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949) GN=proS PE=3 SV=1 269 432 6.0E-08
sp|B7NKX8|SYP_ECO7I Proline--tRNA ligase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=proS PE=3 SV=1 269 427 6.0E-08
sp|B5Z0H4|SYP_ECO5E Proline--tRNA ligase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=proS PE=3 SV=1 269 427 6.0E-08
sp|Q8X8W2|SYP_ECO57 Proline--tRNA ligase OS=Escherichia coli O157:H7 GN=proS PE=3 SV=1 269 427 6.0E-08
sp|Q32JR3|SYP_SHIDS Proline--tRNA ligase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=proS PE=3 SV=1 269 427 6.0E-08
sp|P16659|SYP_ECOLI Proline--tRNA ligase OS=Escherichia coli (strain K12) GN=proS PE=1 SV=4 269 427 6.0E-08
sp|B1XD64|SYP_ECODH Proline--tRNA ligase OS=Escherichia coli (strain K12 / DH10B) GN=proS PE=3 SV=1 269 427 6.0E-08
sp|C4ZRT7|SYP_ECOBW Proline--tRNA ligase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=proS PE=3 SV=1 269 427 6.0E-08
sp|Q0AB94|SYP_ALKEH Proline--tRNA ligase OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=proS PE=3 SV=1 63 234 7.0E-08
sp|Q47Z50|SYP_COLP3 Proline--tRNA ligase OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=proS PE=3 SV=1 269 432 7.0E-08
sp|Q4L5W5|SYP_STAHJ Proline--tRNA ligase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=proS PE=3 SV=1 60 241 7.0E-08
sp|C0RJ44|SYT_BRUMB Threonine--tRNA ligase OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=thrS PE=3 SV=1 70 438 7.0E-08
sp|A1USY3|SYP_BARBK Proline--tRNA ligase OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=proS PE=3 SV=1 65 235 7.0E-08
sp|C5B780|SYP_EDWI9 Proline--tRNA ligase OS=Edwardsiella ictaluri (strain 93-146) GN=proS PE=3 SV=1 269 434 8.0E-08
sp|Q8CST7|SYP_STAES Proline--tRNA ligase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=proS PE=3 SV=1 60 241 8.0E-08
sp|Q5HPS8|SYP_STAEQ Proline--tRNA ligase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=proS PE=3 SV=1 60 241 8.0E-08
sp|A0AIC0|SYP_LISW6 Proline--tRNA ligase OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=proS PE=3 SV=1 63 232 8.0E-08
sp|B8F7C2|SYP_HAEPS Proline--tRNA ligase OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=proS PE=3 SV=1 79 235 8.0E-08
sp|C0Q6L7|SYP_SALPC Proline--tRNA ligase OS=Salmonella paratyphi C (strain RKS4594) GN=proS PE=3 SV=1 269 427 8.0E-08
sp|Q57T14|SYP_SALCH Proline--tRNA ligase OS=Salmonella choleraesuis (strain SC-B67) GN=proS PE=3 SV=2 269 427 8.0E-08
sp|C5CXW9|SYP_VARPS Proline--tRNA ligase OS=Variovorax paradoxus (strain S110) GN=proS PE=3 SV=1 269 421 8.0E-08
sp|Q64VP2|SYT_BACFR Threonine--tRNA ligase OS=Bacteroides fragilis (strain YCH46) GN=thrS PE=3 SV=1 165 443 8.0E-08
sp|Q5LEQ6|SYT_BACFN Threonine--tRNA ligase OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=thrS PE=3 SV=1 165 443 8.0E-08
sp|Q3SH24|SYP_THIDA Proline--tRNA ligase OS=Thiobacillus denitrificans (strain ATCC 25259) GN=proS PE=3 SV=2 269 426 8.0E-08
sp|A9A078|SYT_DESOH Threonine--tRNA ligase OS=Desulfococcus oleovorans (strain DSM 6200 / Hxd3) GN=thrS PE=3 SV=1 70 415 8.0E-08
sp|C0QY98|SYP_BRAHW Proline--tRNA ligase OS=Brachyspira hyodysenteriae (strain ATCC 49526 / WA1) GN=proS PE=3 SV=1 269 444 9.0E-08
sp|A5IGL5|SYP_LEGPC Proline--tRNA ligase OS=Legionella pneumophila (strain Corby) GN=proS PE=3 SV=1 269 440 9.0E-08
sp|Q0AM08|SYT_MARMM Threonine--tRNA ligase OS=Maricaulis maris (strain MCS10) GN=thrS PE=3 SV=1 68 425 9.0E-08
sp|Q5X756|SYP_LEGPA Proline--tRNA ligase OS=Legionella pneumophila (strain Paris) GN=proS PE=3 SV=1 269 440 9.0E-08
sp|Q7MIE5|SYP_VIBVY Proline--tRNA ligase OS=Vibrio vulnificus (strain YJ016) GN=proS PE=3 SV=1 269 441 9.0E-08
sp|Q720A3|SYP_LISMF Proline--tRNA ligase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=proS PE=3 SV=1 63 232 9.0E-08
sp|C6BYX7|SYP_DESAD Proline--tRNA ligase OS=Desulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIB 8403 / VKM B-1763) GN=proS PE=3 SV=1 269 429 9.0E-08
sp|Q8Y7G2|SYP_LISMO Proline--tRNA ligase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=proS PE=3 SV=1 63 232 9.0E-08
sp|A4TL66|SYP_YERPP Proline--tRNA ligase OS=Yersinia pestis (strain Pestoides F) GN=proS PE=3 SV=1 63 235 1.0E-07
sp|Q1CFH2|SYP_YERPN Proline--tRNA ligase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=proS PE=3 SV=1 63 235 1.0E-07
sp|A9R371|SYP_YERPG Proline--tRNA ligase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=proS PE=3 SV=1 63 235 1.0E-07
sp|Q7CH25|SYP_YERPE Proline--tRNA ligase OS=Yersinia pestis GN=proS PE=3 SV=1 63 235 1.0E-07
sp|Q1CAK9|SYP_YERPA Proline--tRNA ligase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=proS PE=3 SV=1 63 235 1.0E-07
sp|Q667L4|SYP_YERPS Proline--tRNA ligase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=proS PE=3 SV=1 63 235 1.0E-07
sp|B2JZ09|SYP_YERPB Proline--tRNA ligase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=proS PE=3 SV=1 63 235 1.0E-07
sp|B1JQI5|SYP_YERPY Proline--tRNA ligase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=proS PE=3 SV=1 63 235 1.0E-07
sp|A7FFJ4|SYP_YERP3 Proline--tRNA ligase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=proS PE=3 SV=1 63 235 1.0E-07
sp|Q7N8M7|SYP_PHOLL Proline--tRNA ligase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=proS PE=3 SV=1 269 432 1.0E-07
sp|A6VKR5|SYP_ACTSZ Proline--tRNA ligase OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=proS PE=3 SV=1 269 427 1.0E-07
sp|A9MPG5|SYP_SALAR Proline--tRNA ligase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=proS PE=3 SV=1 63 235 1.0E-07
sp|B5Y1H7|SYP_KLEP3 Proline--tRNA ligase OS=Klebsiella pneumoniae (strain 342) GN=proS PE=3 SV=1 63 235 1.0E-07
sp|A5UDZ4|SYP_HAEIE Proline--tRNA ligase OS=Haemophilus influenzae (strain PittEE) GN=proS PE=3 SV=1 269 427 1.0E-07
sp|A6T4Z7|SYP_KLEP7 Proline--tRNA ligase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=proS PE=3 SV=1 63 235 1.0E-07
sp|Q1RFZ4|SYP_ECOUT Proline--tRNA ligase OS=Escherichia coli (strain UTI89 / UPEC) GN=proS PE=3 SV=2 63 235 1.0E-07
sp|B1LGZ7|SYP_ECOSM Proline--tRNA ligase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=proS PE=3 SV=1 63 235 1.0E-07
sp|Q8FKZ4|SYP_ECOL6 Proline--tRNA ligase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=proS PE=3 SV=2 63 235 1.0E-07
sp|Q0TLD7|SYP_ECOL5 Proline--tRNA ligase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=proS PE=3 SV=1 63 235 1.0E-07
sp|A1A7N8|SYP_ECOK1 Proline--tRNA ligase OS=Escherichia coli O1:K1 / APEC GN=proS PE=3 SV=1 63 235 1.0E-07
sp|B7MP55|SYP_ECO81 Proline--tRNA ligase OS=Escherichia coli O81 (strain ED1a) GN=proS PE=3 SV=1 63 235 1.0E-07
sp|B7MBH6|SYP_ECO45 Proline--tRNA ligase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=proS PE=3 SV=1 63 235 1.0E-07
sp|B7UJ96|SYP_ECO27 Proline--tRNA ligase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=proS PE=3 SV=1 63 235 1.0E-07
sp|B7LW79|SYP_ESCF3 Proline--tRNA ligase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=proS PE=3 SV=1 63 235 1.0E-07
sp|B8IZD1|SYP_DESDA Proline--tRNA ligase OS=Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949) GN=proS PE=3 SV=1 63 235 1.0E-07
sp|C0Q6L7|SYP_SALPC Proline--tRNA ligase OS=Salmonella paratyphi C (strain RKS4594) GN=proS PE=3 SV=1 63 235 1.0E-07
sp|Q57T14|SYP_SALCH Proline--tRNA ligase OS=Salmonella choleraesuis (strain SC-B67) GN=proS PE=3 SV=2 63 235 1.0E-07
sp|Q8K9S2|SYP_BUCAP Proline--tRNA ligase OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=proS PE=3 SV=1 269 432 1.0E-07
sp|Q24UG7|SYP_DESHY Proline--tRNA ligase OS=Desulfitobacterium hafniense (strain Y51) GN=proS PE=3 SV=1 268 436 1.0E-07
sp|Q8DBH9|SYP_VIBVU Proline--tRNA ligase OS=Vibrio vulnificus (strain CMCP6) GN=proS PE=3 SV=1 269 432 1.0E-07
sp|Q8G3N0|SYP_BIFLO Proline--tRNA ligase OS=Bifidobacterium longum (strain NCC 2705) GN=proS PE=3 SV=1 269 400 1.0E-07
sp|C1L2M5|SYP_LISMC Proline--tRNA ligase OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=proS PE=3 SV=1 63 232 1.0E-07
sp|A8AL94|SYP_CITK8 Proline--tRNA ligase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=proS PE=3 SV=1 269 432 1.0E-07
sp|A8AL94|SYP_CITK8 Proline--tRNA ligase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=proS PE=3 SV=1 63 235 1.0E-07
sp|Q97ED5|SYP_CLOAB Proline--tRNA ligase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=proS PE=3 SV=1 268 441 1.0E-07
sp|Q4QMG5|SYP_HAEI8 Proline--tRNA ligase OS=Haemophilus influenzae (strain 86-028NP) GN=proS PE=3 SV=1 269 427 1.0E-07
sp|B8FR28|SYP_DESHD Proline--tRNA ligase OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=proS PE=3 SV=1 269 436 1.0E-07
sp|Q74D59|SYP_GEOSL Proline--tRNA ligase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=proS PE=3 SV=1 269 440 1.0E-07
sp|Q3IGT7|SYP_PSEHT Proline--tRNA ligase OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=proS PE=3 SV=2 63 235 1.0E-07
sp|B8DG08|SYP_LISMH Proline--tRNA ligase OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=proS PE=3 SV=1 63 232 1.0E-07
sp|Q3A6R6|SYP_PELCD Proline--tRNA ligase OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=proS PE=3 SV=1 269 440 1.0E-07
sp|Q30S93|SYP_SULDN Proline--tRNA ligase OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=proS PE=3 SV=1 76 235 1.0E-07
sp|A0PZN1|SYT_CLONN Threonine--tRNA ligase OS=Clostridium novyi (strain NT) GN=thrS PE=3 SV=1 71 441 1.0E-07
sp|Q5FGP1|SYT_EHRRG Threonine--tRNA ligase OS=Ehrlichia ruminantium (strain Gardel) GN=thrS PE=3 SV=1 70 233 1.0E-07
sp|Q03FS9|SYP_PEDPA Proline--tRNA ligase OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=proS PE=3 SV=1 269 444 1.0E-07
sp|B8GPP4|SYP_THISH Proline--tRNA ligase OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=proS PE=3 SV=1 269 421 1.0E-07
sp|A9KGU5|SYP_COXBN Proline--tRNA ligase OS=Coxiella burnetii (strain Dugway 5J108-111) GN=proS PE=3 SV=1 259 432 1.0E-07
sp|C3MB49|SYT_RHISN Threonine--tRNA ligase OS=Rhizobium sp. (strain NGR234) GN=thrS PE=3 SV=1 70 418 1.0E-07
sp|A5WDG2|SYP_PSYWF Proline--tRNA ligase OS=Psychrobacter sp. (strain PRwf-1) GN=proS PE=3 SV=1 64 235 1.0E-07
sp|Q0AAL5|SYT_ALKEH Threonine--tRNA ligase OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=thrS PE=3 SV=1 70 429 1.0E-07
sp|C4LBX6|SYP_TOLAT Proline--tRNA ligase OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=proS PE=3 SV=1 63 235 2.0E-07
sp|Q9CL72|SYP_PASMU Proline--tRNA ligase OS=Pasteurella multocida (strain Pm70) GN=proS PE=3 SV=1 79 235 2.0E-07
sp|Q7CR62|SYP_SALTY Proline--tRNA ligase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=proS PE=3 SV=1 63 235 2.0E-07
sp|Q8XEY9|SYP_SALTI Proline--tRNA ligase OS=Salmonella typhi GN=proS PE=3 SV=1 63 235 2.0E-07
sp|B5BAQ2|SYP_SALPK Proline--tRNA ligase OS=Salmonella paratyphi A (strain AKU_12601) GN=proS PE=3 SV=1 63 235 2.0E-07
sp|A9N0U7|SYP_SALPB Proline--tRNA ligase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=proS PE=3 SV=1 63 235 2.0E-07
sp|Q5PD80|SYP_SALPA Proline--tRNA ligase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=proS PE=3 SV=1 63 235 2.0E-07
sp|B4SV24|SYP_SALNS Proline--tRNA ligase OS=Salmonella newport (strain SL254) GN=proS PE=3 SV=1 63 235 2.0E-07
sp|B4TK70|SYP_SALHS Proline--tRNA ligase OS=Salmonella heidelberg (strain SL476) GN=proS PE=3 SV=1 63 235 2.0E-07
sp|B5R5J8|SYP_SALG2 Proline--tRNA ligase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=proS PE=3 SV=1 63 235 2.0E-07
sp|B5R434|SYP_SALEP Proline--tRNA ligase OS=Salmonella enteritidis PT4 (strain P125109) GN=proS PE=3 SV=1 63 235 2.0E-07
sp|B5FJ42|SYP_SALDC Proline--tRNA ligase OS=Salmonella dublin (strain CT_02021853) GN=proS PE=3 SV=1 63 235 2.0E-07
sp|B5F8V6|SYP_SALA4 Proline--tRNA ligase OS=Salmonella agona (strain SL483) GN=proS PE=3 SV=1 63 235 2.0E-07
sp|B4TYF5|SYP_SALSV Proline--tRNA ligase OS=Salmonella schwarzengrund (strain CVM19633) GN=proS PE=3 SV=1 63 235 2.0E-07
sp|A4W6T9|SYP_ENT38 Proline--tRNA ligase OS=Enterobacter sp. (strain 638) GN=proS PE=3 SV=1 63 235 2.0E-07
sp|A7MI22|SYP_CROS8 Proline--tRNA ligase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=proS PE=3 SV=1 269 427 2.0E-07
sp|B7N862|SYP_ECOLU Proline--tRNA ligase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=proS PE=3 SV=1 63 235 2.0E-07
sp|B7LHA4|SYP_ECO55 Proline--tRNA ligase OS=Escherichia coli (strain 55989 / EAEC) GN=proS PE=3 SV=1 63 235 2.0E-07
sp|Q3Z5G3|SYP_SHISS Proline--tRNA ligase OS=Shigella sonnei (strain Ss046) GN=proS PE=3 SV=1 63 235 2.0E-07
sp|Q83MC8|SYP_SHIFL Proline--tRNA ligase OS=Shigella flexneri GN=proS PE=3 SV=4 63 235 2.0E-07
sp|Q0T815|SYP_SHIF8 Proline--tRNA ligase OS=Shigella flexneri serotype 5b (strain 8401) GN=proS PE=3 SV=2 63 235 2.0E-07
sp|Q325U6|SYP_SHIBS Proline--tRNA ligase OS=Shigella boydii serotype 4 (strain Sb227) GN=proS PE=3 SV=1 63 235 2.0E-07
sp|B2U338|SYP_SHIB3 Proline--tRNA ligase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=proS PE=3 SV=1 63 235 2.0E-07
sp|B6HZR3|SYP_ECOSE Proline--tRNA ligase OS=Escherichia coli (strain SE11) GN=proS PE=3 SV=1 63 235 2.0E-07
sp|B1IQE6|SYP_ECOLC Proline--tRNA ligase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=proS PE=3 SV=1 63 235 2.0E-07
sp|A7ZWE2|SYP_ECOHS Proline--tRNA ligase OS=Escherichia coli O9:H4 (strain HS) GN=proS PE=3 SV=1 63 235 2.0E-07
sp|B7M1Z9|SYP_ECO8A Proline--tRNA ligase OS=Escherichia coli O8 (strain IAI1) GN=proS PE=3 SV=1 63 235 2.0E-07
sp|A7ZHT6|SYP_ECO24 Proline--tRNA ligase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=proS PE=3 SV=1 63 235 2.0E-07
sp|B5Z0H4|SYP_ECO5E Proline--tRNA ligase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=proS PE=3 SV=1 63 235 2.0E-07
sp|Q8X8W2|SYP_ECO57 Proline--tRNA ligase OS=Escherichia coli O157:H7 GN=proS PE=3 SV=1 63 235 2.0E-07
sp|Q32JR3|SYP_SHIDS Proline--tRNA ligase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=proS PE=3 SV=1 63 235 2.0E-07
sp|P16659|SYP_ECOLI Proline--tRNA ligase OS=Escherichia coli (strain K12) GN=proS PE=1 SV=4 63 235 2.0E-07
sp|B1XD64|SYP_ECODH Proline--tRNA ligase OS=Escherichia coli (strain K12 / DH10B) GN=proS PE=3 SV=1 63 235 2.0E-07
sp|C4ZRT7|SYP_ECOBW Proline--tRNA ligase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=proS PE=3 SV=1 63 235 2.0E-07
sp|A1WUX1|SYP_HALHL Proline--tRNA ligase OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=proS PE=3 SV=1 63 234 2.0E-07
sp|Q0AGN2|SYP_NITEC Proline--tRNA ligase OS=Nitrosomonas eutropha (strain C91) GN=proS PE=3 SV=1 269 419 2.0E-07
sp|Q1QVL8|SYP_CHRSD Proline--tRNA ligase OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=proS PE=3 SV=1 269 421 2.0E-07
sp|B4RV73|SYP_ALTMD Proline--tRNA ligase OS=Alteromonas macleodii (strain DSM 17117 / Deep ecotype) GN=proS PE=3 SV=1 269 430 2.0E-07
sp|A9N9Z2|SYP_COXBR Proline--tRNA ligase OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=proS PE=3 SV=1 259 432 2.0E-07
sp|Q83F67|SYP_COXBU Proline--tRNA ligase OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=proS PE=3 SV=1 259 432 2.0E-07
sp|A5D2U6|SYP_PELTS Proline--tRNA ligase OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=proS PE=3 SV=1 269 443 2.0E-07
sp|A7N1W0|SYP_VIBCB Proline--tRNA ligase OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=proS PE=3 SV=1 269 432 2.0E-07
sp|Q82UZ8|SYP_NITEU Proline--tRNA ligase OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=proS PE=3 SV=1 269 419 2.0E-07
sp|Q9I502|SYP_PSEAE Proline--tRNA ligase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=proS PE=3 SV=1 269 440 2.0E-07
sp|B7UXX6|SYP_PSEA8 Proline--tRNA ligase OS=Pseudomonas aeruginosa (strain LESB58) GN=proS PE=3 SV=1 269 440 2.0E-07
sp|Q8RIE2|SYP_FUSNN Proline--tRNA ligase OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=proS PE=3 SV=1 267 440 2.0E-07
sp|A5EXK9|SYP_DICNV Proline--tRNA ligase OS=Dichelobacter nodosus (strain VCS1703A) GN=proS PE=3 SV=1 269 435 2.0E-07
sp|Q9JU09|SYP_NEIMA Proline--tRNA ligase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=proS PE=3 SV=1 269 440 2.0E-07
sp|B8EDD0|SYP_SHEB2 Proline--tRNA ligase OS=Shewanella baltica (strain OS223) GN=proS PE=3 SV=1 63 235 3.0E-07
sp|A6WQB8|SYP_SHEB8 Proline--tRNA ligase OS=Shewanella baltica (strain OS185) GN=proS PE=3 SV=1 63 235 3.0E-07
sp|A3D6H7|SYP_SHEB5 Proline--tRNA ligase OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=proS PE=3 SV=1 63 235 3.0E-07
sp|A9KVR8|SYP_SHEB9 Proline--tRNA ligase OS=Shewanella baltica (strain OS195) GN=proS PE=3 SV=1 63 235 3.0E-07
sp|B4RBZ9|SYP_PHEZH Proline--tRNA ligase OS=Phenylobacterium zucineum (strain HLK1) GN=proS PE=3 SV=1 63 240 3.0E-07
sp|A8GIB4|SYP_SERP5 Proline--tRNA ligase OS=Serratia proteamaculans (strain 568) GN=proS PE=3 SV=1 63 235 3.0E-07
sp|B8DNM5|SYP_DESVM Proline--tRNA ligase OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=proS PE=3 SV=1 269 429 3.0E-07
sp|A2C155|SYT_PROM1 Threonine--tRNA ligase OS=Prochlorococcus marinus (strain NATL1A) GN=thrS PE=3 SV=1 68 429 3.0E-07
sp|A3DJL6|SYP_CLOTH Proline--tRNA ligase OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=proS PE=3 SV=1 270 435 3.0E-07
sp|Q5H9Z4|SYT_EHRRW Threonine--tRNA ligase OS=Ehrlichia ruminantium (strain Welgevonden) GN=thrS PE=3 SV=1 70 233 3.0E-07
sp|P43830|SYP_HAEIN Proline--tRNA ligase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=proS PE=1 SV=1 269 427 3.0E-07
sp|Q6G3A4|SYP_BARHE Proline--tRNA ligase OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=proS PE=3 SV=1 63 215 3.0E-07
sp|Q88VK1|SYP_LACPL Proline--tRNA ligase OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=proS PE=3 SV=1 269 443 3.0E-07
sp|Q9KYR6|SYP_STRCO Proline--tRNA ligase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=proS PE=3 SV=1 269 429 3.0E-07
sp|A7GRE9|SYP_BACCN Proline--tRNA ligase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=proS PE=3 SV=1 63 232 3.0E-07
sp|Q98KS5|SYP_RHILO Proline--tRNA ligase OS=Rhizobium loti (strain MAFF303099) GN=proS PE=3 SV=1 267 430 3.0E-07
sp|A9M375|SYT_NEIM0 Threonine--tRNA ligase OS=Neisseria meningitidis serogroup C (strain 053442) GN=thrS PE=3 SV=1 70 429 3.0E-07
sp|Q8ECI8|SYP_SHEON Proline--tRNA ligase OS=Shewanella oneidensis (strain MR-1) GN=proS PE=3 SV=1 63 235 4.0E-07
sp|A1WUX1|SYP_HALHL Proline--tRNA ligase OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=proS PE=3 SV=1 269 432 4.0E-07
sp|B2IDI9|SYP_BEII9 Proline--tRNA ligase OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=proS PE=3 SV=1 63 240 4.0E-07
sp|Q49X48|SYP_STAS1 Proline--tRNA ligase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=proS PE=3 SV=1 243 443 4.0E-07
sp|Q9A6Z5|SYP_CAUCR Proline--tRNA ligase OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=proS PE=3 SV=1 267 432 4.0E-07
sp|B8GWT1|SYP_CAUCN Proline--tRNA ligase OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=proS PE=3 SV=1 267 432 4.0E-07
sp|B7VIT2|SYP_VIBTL Proline--tRNA ligase OS=Vibrio tasmaniensis (strain LGP32) GN=proS PE=3 SV=1 269 436 4.0E-07
sp|A5UHN3|SYP_HAEIG Proline--tRNA ligase OS=Haemophilus influenzae (strain PittGG) GN=proS PE=3 SV=1 269 427 4.0E-07
sp|Q0HKJ4|SYP_SHESM Proline--tRNA ligase OS=Shewanella sp. (strain MR-4) GN=proS PE=3 SV=1 63 235 5.0E-07
sp|Q0HWU6|SYP_SHESR Proline--tRNA ligase OS=Shewanella sp. (strain MR-7) GN=proS PE=3 SV=1 63 235 5.0E-07
sp|Q03FS9|SYP_PEDPA Proline--tRNA ligase OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=proS PE=3 SV=1 74 232 5.0E-07
sp|A5UHN3|SYP_HAEIG Proline--tRNA ligase OS=Haemophilus influenzae (strain PittGG) GN=proS PE=3 SV=1 79 235 5.0E-07
sp|Q12L53|SYP_SHEDO Proline--tRNA ligase OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=proS PE=3 SV=1 63 235 6.0E-07
sp|A0KV13|SYP_SHESA Proline--tRNA ligase OS=Shewanella sp. (strain ANA-3) GN=proS PE=3 SV=1 63 235 6.0E-07
sp|A4SJ23|SYP_AERS4 Proline--tRNA ligase OS=Aeromonas salmonicida (strain A449) GN=proS PE=3 SV=1 63 212 7.0E-07
sp|P43830|SYP_HAEIN Proline--tRNA ligase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=proS PE=1 SV=1 79 235 7.0E-07
sp|A1RI33|SYP_SHESW Proline--tRNA ligase OS=Shewanella sp. (strain W3-18-1) GN=proS PE=3 SV=1 63 235 8.0E-07
sp|A4Y8F6|SYP_SHEPC Proline--tRNA ligase OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=proS PE=3 SV=1 63 235 8.0E-07
sp|Q07ZH1|SYP_SHEFN Proline--tRNA ligase OS=Shewanella frigidimarina (strain NCIMB 400) GN=proS PE=3 SV=1 63 215 8.0E-07
sp|A0KPA5|SYP_AERHH Proline--tRNA ligase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=proS PE=3 SV=1 63 212 8.0E-07
sp|A0AIC0|SYP_LISW6 Proline--tRNA ligase OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=proS PE=3 SV=1 270 423 8.0E-07
sp|Q4QMG5|SYP_HAEI8 Proline--tRNA ligase OS=Haemophilus influenzae (strain 86-028NP) GN=proS PE=3 SV=1 79 235 8.0E-07
sp|Q49X48|SYP_STAS1 Proline--tRNA ligase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=proS PE=3 SV=1 60 241 8.0E-07
sp|A3QG64|SYP_SHELP Proline--tRNA ligase OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=proS PE=3 SV=1 63 235 1.0E-06
sp|B7NKX8|SYP_ECO7I Proline--tRNA ligase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=proS PE=3 SV=1 63 235 1.0E-06
sp|B4RV73|SYP_ALTMD Proline--tRNA ligase OS=Alteromonas macleodii (strain DSM 17117 / Deep ecotype) GN=proS PE=3 SV=1 63 235 1.0E-06
sp|A5FX26|SYP_ACICJ Proline--tRNA ligase OS=Acidiphilium cryptum (strain JF-5) GN=proS PE=3 SV=1 63 235 2.0E-06
sp|C6DDF6|SYP_PECCP Proline--tRNA ligase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=proS PE=3 SV=1 63 215 2.0E-06
sp|Q3IGT7|SYP_PSEHT Proline--tRNA ligase OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=proS PE=3 SV=2 269 429 2.0E-06
sp|Q6D1B9|SYP_PECAS Proline--tRNA ligase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=proS PE=3 SV=1 63 215 3.0E-06
sp|B8F7C2|SYP_HAEPS Proline--tRNA ligase OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=proS PE=3 SV=1 269 427 3.0E-06
sp|Q88VK1|SYP_LACPL Proline--tRNA ligase OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=proS PE=3 SV=1 60 235 3.0E-06
sp|Q15WD6|SYP_PSEA6 Proline--tRNA ligase OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=proS PE=3 SV=1 63 235 4.0E-06
sp|B0RZJ0|SYP_FINM2 Proline--tRNA ligase OS=Finegoldia magna (strain ATCC 29328) GN=proS PE=3 SV=1 63 243 6.0E-06
sp|A7GRE9|SYP_BACCN Proline--tRNA ligase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=proS PE=3 SV=1 268 441 6.0E-06
sp|Q0VRL1|SYP_ALCBS Proline--tRNA ligase OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=proS PE=3 SV=2 63 235 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0006433 prolyl-tRNA aminoacylation Yes
GO:0000166 nucleotide binding Yes
GO:0005737 cytoplasm Yes
GO:0005524 ATP binding Yes
GO:0006418 tRNA aminoacylation for protein translation Yes
GO:0004827 proline-tRNA ligase activity Yes
GO:0004812 aminoacyl-tRNA ligase activity Yes
GO:0006399 tRNA metabolic process No
GO:0008150 biological_process No
GO:0008152 metabolic process No
GO:0017076 purine nucleotide binding No
GO:0030554 adenyl nucleotide binding No
GO:0032553 ribonucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0034660 ncRNA metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0016874 ligase activity No
GO:1901265 nucleoside phosphate binding No
GO:0005575 cellular_component No
GO:0006520 cellular amino acid metabolic process No
GO:0044281 small molecule metabolic process No
GO:0044238 primary metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0140101 catalytic activity, acting on a tRNA No
GO:0043436 oxoacid metabolic process No
GO:0006082 organic acid metabolic process No
GO:0043168 anion binding No
GO:0019752 carboxylic acid metabolic process No
GO:0043167 ion binding No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0043038 amino acid activation No
GO:1901360 organic cyclic compound metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0016070 RNA metabolic process No
GO:0032555 purine ribonucleotide binding No
GO:0003824 catalytic activity No
GO:0044237 cellular metabolic process No
GO:0097367 carbohydrate derivative binding No
GO:1901564 organonitrogen compound metabolic process No
GO:0032559 adenyl ribonucleotide binding No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0097159 organic cyclic compound binding No
GO:0140098 catalytic activity, acting on RNA No
GO:0110165 cellular anatomical entity No
GO:0003674 molecular_function No
GO:0090304 nucleic acid metabolic process No
GO:0016875 ligase activity, forming carbon-oxygen bonds No
GO:0036094 small molecule binding No
GO:0071704 organic substance metabolic process No
GO:0005488 binding No
GO:0006807 nitrogen compound metabolic process No
GO:0043039 tRNA aminoacylation No
GO:0043170 macromolecule metabolic process No
GO:0009987 cellular process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4229
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3976 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|4643
Ophiocordyceps camponoti-floridani Ophcf2|02874
Ophiocordyceps camponoti-rufipedis Ophun1|5630
Ophiocordyceps kimflemingae Ophio5|1079
Ophiocordyceps subramaniannii Hirsu2|8634

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|3976
MDTPGEPSKSALKKAEKQARLAAEKATKAAKKPTTVPVVGGKKTDDIIGITVSKNDNFPAWYQEVVLKADLVEYY
QEISGFFVLRPQAMHVWAIIRKWFQERIEAMGVDEVSFPLFLSAKSLEREKDHVEGFAPELAWVTKAGDKDLEVP
VAIRPTSEAVMYPYYSKWIRSHRDLPLRLNQWNSVVRWEAKQTTPFLRTREFLWQEGHTAHLTEELAGEEVLQIL
ELYAGVYEQLLALPVVRGRKTENEKFAGGYYTTTVEGYVPANGRGIQGGTSHCLGQNFSKMFDITVEDPINKGSH
LHVWQNSWGLSTRVIGVMVMVHGDDKGLVMPPRVAKVQTILIPVGINKSTTPEDRKKHEEQVESIRTALKKAGVR
AESDWREGYTPAWKFNDWELKGVPLRIEFGPKDAAKEVVSYARRDTGEKGTIPIAHVGAKVPELLETIQHDMYTK
AEANFEKHRVTITKWNDVLPALDNKNVVLIPFCLDGKCEDRMKELTTRIDENPDLPENQKLPSMGMKSLCIPFEQ
PSGDSLVPGQTACLNPECQRKAQKWVMFGRSY*
Coding >OphauG2|3976
ATGGACACCCCGGGAGAGCCATCCAAGAGCGCGCTGAAAAAGGCGGAGAAGCAGGCCAGGCTTGCCGCCGAGAAG
GCTACCAAGGCGGCAAAAAAACCCACGACGGTGCCTGTGGTGGGAGGCAAGAAGACGGACGACATTATTGGCATC
ACGGTTTCCAAGAATGACAACTTTCCGGCATGGTACCAAGAGGTGGTGCTCAAGGCCGACTTGGTCGAGTACTAC
CAGGAAATCTCGGGCTTCTTCGTCCTGCGGCCGCAGGCCATGCACGTCTGGGCCATTATCCGCAAGTGGTTTCAG
GAGAGAATCGAGGCAATGGGTGTCGACGAGGTCAGCTTTCCTCTCTTTCTCTCGGCCAAGTCTCTTGAGAGGGAA
AAGGACCATGTCGAGGGCTTTGCCCCAGAACTCGCATGGGTCACCAAGGCTGGCGACAAAGACTTGGAGGTTCCC
GTTGCTATCCGTCCAACCTCGGAAGCTGTCATGTATCCCTACTATTCCAAATGGATTCGTAGTCATAGGGACCTT
CCGCTGCGACTGAATCAATGGAACTCGGTGGTGCGGTGGGAGGCCAAGCAGACGACTCCGTTTCTTCGCACACGC
GAGTTCCTTTGGCAAGAAGGCCACACAGCCCACTTGACTGAGGAGCTCGCAGGGGAAGAGGTGTTGCAGATATTG
GAGCTATACGCAGGTGTGTATGAACAACTTTTGGCGCTTCCTGTTGTGCGAGGGCGCAAAACGGAAAATGAAAAA
TTTGCTGGCGGCTACTACACCACGACGGTAGAGGGATATGTCCCCGCAAACGGCCGAGGCATTCAAGGCGGCACA
TCGCACTGCTTGGGCCAAAACTTCAGCAAGATGTTTGACATAACGGTAGAGGACCCCATCAACAAGGGTTCGCAT
CTCCATGTTTGGCAGAACTCGTGGGGCCTGTCGACCCGCGTCATTGGCGTCATGGTCATGGTGCATGGAGACGAC
AAGGGCCTGGTAATGCCCCCGCGCGTCGCCAAGGTGCAGACGATTCTTATTCCCGTGGGAATCAACAAGAGCACC
ACTCCAGAGGATAGGAAGAAGCATGAGGAGCAAGTTGAAAGTATCCGAACGGCGTTGAAAAAGGCGGGTGTGCGC
GCCGAATCAGATTGGAGAGAAGGCTACACGCCCGCGTGGAAATTCAACGACTGGGAACTCAAGGGCGTGCCTTTA
AGGATTGAGTTTGGCCCCAAGGACGCAGCCAAGGAAGTAGTCAGCTATGCTCGGAGAGACACTGGTGAAAAGGGC
ACTATCCCCATTGCCCATGTGGGCGCCAAGGTTCCTGAACTTCTCGAGACGATACAACATGACATGTACACCAAG
GCCGAGGCAAACTTTGAAAAACATCGCGTCACTATTACCAAATGGAACGACGTGCTGCCTGCGCTTGACAACAAG
AACGTGGTCTTGATTCCATTTTGCCTAGATGGAAAGTGCGAGGACCGGATGAAGGAGCTGACTACGCGGATTGAC
GAGAACCCCGATCTGCCCGAGAACCAAAAACTTCCGTCAATGGGAATGAAGAGTCTGTGCATTCCGTTTGAGCAG
CCGTCGGGCGACAGCCTTGTTCCGGGGCAGACGGCTTGCCTCAATCCCGAATGCCAGCGCAAGGCGCAAAAATGG
GTCATGTTTGGGCGAAGCTACTAG
Transcript >OphauG2|3976
ATGGACACCCCGGGAGAGCCATCCAAGAGCGCGCTGAAAAAGGCGGAGAAGCAGGCCAGGCTTGCCGCCGAGAAG
GCTACCAAGGCGGCAAAAAAACCCACGACGGTGCCTGTGGTGGGAGGCAAGAAGACGGACGACATTATTGGCATC
ACGGTTTCCAAGAATGACAACTTTCCGGCATGGTACCAAGAGGTGGTGCTCAAGGCCGACTTGGTCGAGTACTAC
CAGGAAATCTCGGGCTTCTTCGTCCTGCGGCCGCAGGCCATGCACGTCTGGGCCATTATCCGCAAGTGGTTTCAG
GAGAGAATCGAGGCAATGGGTGTCGACGAGGTCAGCTTTCCTCTCTTTCTCTCGGCCAAGTCTCTTGAGAGGGAA
AAGGACCATGTCGAGGGCTTTGCCCCAGAACTCGCATGGGTCACCAAGGCTGGCGACAAAGACTTGGAGGTTCCC
GTTGCTATCCGTCCAACCTCGGAAGCTGTCATGTATCCCTACTATTCCAAATGGATTCGTAGTCATAGGGACCTT
CCGCTGCGACTGAATCAATGGAACTCGGTGGTGCGGTGGGAGGCCAAGCAGACGACTCCGTTTCTTCGCACACGC
GAGTTCCTTTGGCAAGAAGGCCACACAGCCCACTTGACTGAGGAGCTCGCAGGGGAAGAGGTGTTGCAGATATTG
GAGCTATACGCAGGTGTGTATGAACAACTTTTGGCGCTTCCTGTTGTGCGAGGGCGCAAAACGGAAAATGAAAAA
TTTGCTGGCGGCTACTACACCACGACGGTAGAGGGATATGTCCCCGCAAACGGCCGAGGCATTCAAGGCGGCACA
TCGCACTGCTTGGGCCAAAACTTCAGCAAGATGTTTGACATAACGGTAGAGGACCCCATCAACAAGGGTTCGCAT
CTCCATGTTTGGCAGAACTCGTGGGGCCTGTCGACCCGCGTCATTGGCGTCATGGTCATGGTGCATGGAGACGAC
AAGGGCCTGGTAATGCCCCCGCGCGTCGCCAAGGTGCAGACGATTCTTATTCCCGTGGGAATCAACAAGAGCACC
ACTCCAGAGGATAGGAAGAAGCATGAGGAGCAAGTTGAAAGTATCCGAACGGCGTTGAAAAAGGCGGGTGTGCGC
GCCGAATCAGATTGGAGAGAAGGCTACACGCCCGCGTGGAAATTCAACGACTGGGAACTCAAGGGCGTGCCTTTA
AGGATTGAGTTTGGCCCCAAGGACGCAGCCAAGGAAGTAGTCAGCTATGCTCGGAGAGACACTGGTGAAAAGGGC
ACTATCCCCATTGCCCATGTGGGCGCCAAGGTTCCTGAACTTCTCGAGACGATACAACATGACATGTACACCAAG
GCCGAGGCAAACTTTGAAAAACATCGCGTCACTATTACCAAATGGAACGACGTGCTGCCTGCGCTTGACAACAAG
AACGTGGTCTTGATTCCATTTTGCCTAGATGGAAAGTGCGAGGACCGGATGAAGGAGCTGACTACGCGGATTGAC
GAGAACCCCGATCTGCCCGAGAACCAAAAACTTCCGTCAATGGGAATGAAGAGTCTGTGCATTCCGTTTGAGCAG
CCGTCGGGCGACAGCCTTGTTCCGGGGCAGACGGCTTGCCTCAATCCCGAATGCCAGCGCAAGGCGCAAAAATGG
GTCATGTTTGGGCGAAGCTACTAG
Gene >OphauG2|3976
ATGGACACCCCGGGAGAGCCATCCAAGAGCGCGCTGAAAAAGGCGGAGAAGCAGGCCAGGCTTGCCGCCGAGAAG
GCTACCAAGGCGGCAAAAAAACCCACGACGGTGCCTGTGGTGGGAGGCAAGAAGACGGACGACATTATTGGCATC
ACGGTTTCCAAGAATGACAACTTTCCGGCATGGTACCAAGAGGTGGTGCTCAAGGCCGACTTGGTCGAGTACTAC
CAGGAAATCTCGGGCTTCTTCGTCCTGCGGCCGCAGGCCATGCACGTCTGGGCCATTATCCGCAAGTGGTTTCAG
GAGAGAATCGAGGCAATGGGTGTCGACGAGGTCAGCTTTCCTCTCTTTCTCTCGGCCAAGTCTCTTGAGAGGGAA
AAGGACCATGTCGAGGGCTTTGCCCCAGAACTCGCATGGGTCACCAAGGCGTACGTATTGACTTGTACATTTGTC
CCCCTACAACCAAGTGCTTACTCGGCGGCAGTGGCGACAAAGACTTGGAGGTTCCCGTTGCTATCCGTCCAACCT
CGGAAGCTGTCATGTATCCCTACTATTCCAAATGGATTCGTAGTCATAGGGACCTTCCGCTGCGACTGAATCAAT
GGAACTCGGTGGTGCGGTGGGAGGCCAAGCAGACGACTCCGTTTCTTCGCACACGCGAGTTCCTTTGGCAAGAAG
GCCACACAGCCCACTTGACTGAGGAGCTCGCAGGGGAAGAGGTGTTGCAGATATTGGAGCTATACGCAGGTGTGT
ATGAACAACTTTTGGCGCTTCCTGTTGTGCGAGGGCGCAAAACGGAAAATGAAAAATTTGCTGGCGGCTACTACA
CCACGACGGTAGAGGGATATGTCCCCGCAAACGGCCGAGGCATTCAAGGCGGCACATCGCACTGCTTGGGCCAAA
ACTTCAGCAAGATGTTTGACATAACGGTAGAGGACCCCATCAACAAGGGTTCGCATCTCCATGTTTGGCAGAACT
CGTGGGGCCTGTCGACCCGCGTCATTGGCGTCATGGTCATGGTGCATGGAGACGACAAGGGCCTGGTAATGCCCC
CGCGCGTCGCCAAGGTGCAGACGATTCTTATTCCCGTGGGAATCAACAAGAGCACCACTCCAGAGGATAGGAAGA
AGCATGAGGAGCAAGTTGAAAGTATCCGAACGGCGTTGAAAAAGGCGGGTGTGCGCGCCGAATCAGATTGGAGAG
AAGGCTACACGCCCGCGTGGAAATTCAACGACTGGGAACTCAAGGGCGTGCCTTTAAGGATTGAGTTTGGCCCCA
AGGACGCAGCCAAGGAAGTAGTCAGCTATGCTCGGAGAGACACTGGTGAAAAGGGCACTATCCCCATTGCCCATG
TGGGCGCCAAGGTTCCTGAACTTCTCGAGACGATACAACATGACATGTACACCAAGGCCGAGGCAAACTTTGAAA
AACATCGCGTCACTATTACCAAATGGAACGACGTGCTGCCTGCGCTTGACAACAAGAACGTGGTCTTGATTCCAT
TTTGCCTAGATGGAAAGTGCGAGGACCGGATGAAGGAGCTGACTACGCGGATTGACGAGAACCCCGATCTGCCCG
AGAACCAAAAACTTCCGTCAATGGGAATGAAGAGTCTGTGCATTCCGTTTGAGCAGCCGTCGGGCGACAGCCTTG
TTCCGGGGCAGACGGCTTGCCTCAATCCCGAATGCCAGCGCAAGGCGCAAAAATGGGTCATGTTTGGGCGAAGCT
ACTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail