Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|3971
Gene name
LocationContig_314:17843..19335
Strand+
Gene length (bp)1492
Transcript length (bp)1353
Coding sequence length (bp)1353
Protein length (aa) 451

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00026 Asp Eukaryotic aspartyl protease 2.4E-31 116 446

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4WFS2|Y1220_ASPFU Probable aspartic-type endopeptidase AFUA_3G01220 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_3G01220 PE=3 SV=2 118 446 3.0E-52
sp|P22929|CARP_SACFI Acid protease OS=Saccharomycopsis fibuligera GN=PEP1 PE=3 SV=1 107 444 3.0E-21
sp|Q64411|PEPC_CAVPO Gastricsin OS=Cavia porcellus GN=PGC PE=2 SV=1 60 446 3.0E-13
sp|P04073|PEPC_RAT Gastricsin OS=Rattus norvegicus GN=Pgc PE=1 SV=1 118 444 4.0E-13
sp|P03955|PEPC_MACFU Gastricsin (Fragment) OS=Macaca fuscata fuscata GN=PGC PE=1 SV=2 60 446 2.0E-12
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4WFS2|Y1220_ASPFU Probable aspartic-type endopeptidase AFUA_3G01220 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_3G01220 PE=3 SV=2 118 446 3.0E-52
sp|P22929|CARP_SACFI Acid protease OS=Saccharomycopsis fibuligera GN=PEP1 PE=3 SV=1 107 444 3.0E-21
sp|Q64411|PEPC_CAVPO Gastricsin OS=Cavia porcellus GN=PGC PE=2 SV=1 60 446 3.0E-13
sp|P04073|PEPC_RAT Gastricsin OS=Rattus norvegicus GN=Pgc PE=1 SV=1 118 444 4.0E-13
sp|P03955|PEPC_MACFU Gastricsin (Fragment) OS=Macaca fuscata fuscata GN=PGC PE=1 SV=2 60 446 2.0E-12
sp|O01530|ASP6_CAEEL Aspartic protease 6 OS=Caenorhabditis elegans GN=asp-6 PE=3 SV=1 66 446 6.0E-12
sp|Q9GMY3|PEPC_RHIFE Gastricsin OS=Rhinolophus ferrumequinum GN=PGC PE=2 SV=1 118 446 6.0E-12
sp|P43232|CARP5_RHINI Rhizopuspepsin-5 OS=Rhizopus niveus PE=3 SV=2 107 438 1.0E-11
sp|Q9D7R7|PEPC_MOUSE Gastricsin OS=Mus musculus GN=Pgc PE=2 SV=1 11 440 2.0E-11
sp|Q03700|CARP4_RHINI Rhizopuspepsin-4 OS=Rhizopus niveus PE=3 SV=1 107 438 3.0E-11
sp|D4D8U6|CTSD_TRIVH Probable aspartic-type endopeptidase CTSD OS=Trichophyton verrucosum (strain HKI 0517) GN=CTSD PE=3 SV=1 100 450 6.0E-11
sp|Q03699|CARP3_RHINI Rhizopuspepsin-3 OS=Rhizopus niveus PE=3 SV=1 107 438 8.0E-11
sp|Q9GMY4|PEPC_SORUN Gastricsin OS=Sorex unguiculatus GN=PGC PE=2 SV=1 60 446 2.0E-10
sp|Q9GMY2|PEPC_RABIT Gastricsin OS=Oryctolagus cuniculus GN=PGC PE=2 SV=1 118 446 2.0E-10
sp|P81498|PEPC_SUNMU Gastricsin OS=Suncus murinus GN=PGC PE=1 SV=2 87 446 2.0E-10
sp|Q12303|YPS3_YEAST Aspartic proteinase yapsin-3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPS3 PE=1 SV=1 75 444 3.0E-10
sp|P06026|CARP_RHICH Rhizopuspepsin OS=Rhizopus chinensis PE=1 SV=2 107 440 4.0E-10
sp|P12630|BAR1_YEAST Barrierpepsin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BAR1 PE=1 SV=1 106 446 3.0E-09
sp|O60020|ASPR1_PHARH Aspartic protease OS=Phaffia rhodozyma GN=pr1 PE=1 SV=1 121 446 4.0E-09
sp|C5FZ57|Y7979_ARTOC Putative aspergillopepsin A-like aspartic endopeptidase MCYG_07979 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=MCYG_07979 PE=3 SV=1 113 441 6.0E-09
sp|P09177|CARP_RHIPU Mucorpepsin OS=Rhizomucor pusillus PE=1 SV=2 104 446 7.0E-09
sp|Q9HEZ3|PEPB_PENJA Aspartic protease pepB OS=Penicillium janthinellum GN=pepB PE=3 SV=1 37 446 1.0E-08
sp|Q4WNV0|CTSD_ASPFU Aspartic-type endopeptidase ctsD OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ctsD PE=1 SV=1 87 449 2.0E-08
sp|P43231|CARP2_RHINI Rhizopuspepsin-2 OS=Rhizopus niveus PE=3 SV=2 43 438 2.0E-08
sp|Q06902|PEPA_ASPOR Aspartic protease pep1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=pep1 PE=1 SV=2 104 449 3.0E-08
sp|B8NLY9|PEPA_ASPFN Aspartic protease pep1 OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=pep1 PE=3 SV=1 104 449 3.0E-08
sp|P25796|CATE_CAVPO Cathepsin E OS=Cavia porcellus GN=CTSE PE=1 SV=1 118 444 5.0E-08
sp|D4DE18|Y5382_TRIVH Probable aspartic-type endopeptidase TRV_05382 OS=Trichophyton verrucosum (strain HKI 0517) GN=TRV_05382 PE=3 SV=1 100 446 7.0E-08
sp|O96009|NAPSA_HUMAN Napsin-A OS=Homo sapiens GN=NAPSA PE=1 SV=1 82 440 9.0E-08
sp|D4DGR1|Y6366_TRIVH Probable aspartic-type endopeptidase TRV_06366 OS=Trichophyton verrucosum (strain HKI 0517) GN=TRV_06366 PE=3 SV=1 95 441 2.0E-07
sp|D4DEN7|CARP_TRIVH Probable vacuolar protease A OS=Trichophyton verrucosum (strain HKI 0517) GN=PEP2 PE=3 SV=1 83 440 3.0E-07
sp|Q28057|PAG2_BOVIN Pregnancy-associated glycoprotein 2 OS=Bos taurus GN=PAG2 PE=2 SV=1 118 438 3.0E-07
sp|C5FEK4|CTSD_ARTOC Probable aspartic-type endopeptidase CTSD (Fragment) OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=CTSD PE=3 SV=2 119 450 6.0E-07
sp|P00799|CARP_RHIMI Mucorpepsin OS=Rhizomucor miehei PE=1 SV=1 104 446 8.0E-07
sp|D4B385|CARP_ARTBC Probable vacuolar protease A OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=PEP2 PE=3 SV=1 118 440 8.0E-07
sp|P53379|MKC7_YEAST Aspartic proteinase MKC7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MKC7 PE=1 SV=2 165 444 2.0E-06
sp|P10602|CARP1_RHINI Rhizopuspepsin-1 OS=Rhizopus niveus GN=RNAP PE=1 SV=1 107 438 3.0E-06
sp|P00791|PEPA_PIG Pepsin A OS=Sus scrofa GN=PGA PE=1 SV=3 118 438 5.0E-06
sp|O09043|NAPSA_MOUSE Napsin-A OS=Mus musculus GN=Napsa PE=1 SV=1 118 440 6.0E-06
sp|A1DDK1|PEPA_NEOFI Aspartic protease pep1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=pep1 PE=3 SV=1 1 446 6.0E-06
sp|P41748|PEPA_ASPFU Aspartic protease pep1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=pep1 PE=1 SV=2 1 446 6.0E-06
sp|B0Y1V8|PEPA_ASPFC Aspartic protease pep1 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=pep1 PE=3 SV=1 1 446 6.0E-06
sp|B6HL60|PEPA_PENRW Aspartic protease pep1 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=pep1 PE=3 SV=1 118 449 6.0E-06
sp|A1CBR4|PEPA_ASPCL Aspartic protease pep1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=pep1 PE=3 SV=1 97 449 7.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|3971
MRAYSLVPCAVAWSLSLVLAAPTDTEWDISKPLNGITFERAKAVQSGPTPDGPAPRFSRLRNIKGRPSSHSAVSA
LGRVLRGQPDGAHEPMWQNISKAGDFTTQYAIECGWDGVPVWLLFDTGSSDTWAVQKGFRCDDGYGTEDSEAACG
FGKPLIDDFGKGSIEDLHFFLKYGSGERVVGPMGRSEISCGGVTVPEQQVGLANYTYWHGNNMTVGVLGLAYQSL
TSAFYGDVGSEAPWNAMSYSPFLTNAITQGSMDPVFSVALVKNSSEGILAWGGLPPMAMAPRSRTKSAATDLIIA
NLVGQAEASWRYSFYTIVPDGIQWGQTMDSTKYPYIVDTGTTMNYLPPPLAEAVAMAFEPRAVYMYQWGSYFAPC
DAIPPRFAVIISGVEFWINPADLLYQDLRDPLTGYCAVAISSGGSGPYILGDVFLQNVVAVFDVGGAQMRFYSRH
*
Coding >OphauG2|3971
ATGAGAGCATATAGCTTGGTGCCATGTGCAGTAGCGTGGTCTCTGAGTCTGGTTTTGGCTGCGCCGACCGACACT
GAGTGGGACATTTCCAAGCCACTCAACGGCATCACGTTTGAGCGGGCCAAGGCAGTACAAAGCGGCCCAACGCCA
GATGGGCCAGCGCCACGCTTTTCACGCCTTCGCAACATCAAGGGACGACCCAGCTCGCACAGTGCCGTGTCAGCC
CTGGGAAGGGTTTTGCGTGGGCAGCCGGATGGAGCGCATGAGCCCATGTGGCAAAACATTAGCAAGGCTGGCGAC
TTTACGACGCAGTATGCCATTGAGTGCGGATGGGACGGGGTGCCAGTGTGGCTTCTCTTTGACACGGGCAGCTCA
GACACTTGGGCAGTGCAAAAGGGGTTTCGATGTGACGATGGCTACGGGACCGAGGACAGCGAGGCGGCGTGTGGC
TTTGGCAAGCCGCTGATTGACGACTTTGGCAAGGGCAGCATTGAAGACTTGCACTTCTTCCTCAAGTACGGGTCA
GGGGAGCGCGTCGTGGGGCCCATGGGGCGAAGCGAGATATCGTGCGGCGGCGTCACGGTGCCCGAGCAGCAGGTG
GGACTGGCCAACTACACGTACTGGCACGGCAACAATATGACGGTGGGCGTGCTGGGGCTGGCCTATCAGTCGCTG
ACGAGCGCCTTTTACGGCGACGTTGGAAGCGAGGCGCCATGGAACGCCATGTCGTACTCGCCCTTCCTGACAAAT
GCCATTACACAGGGCTCCATGGACCCAGTCTTTAGCGTGGCGCTCGTCAAGAACTCTTCCGAGGGGATTCTGGCG
TGGGGCGGACTGCCGCCCATGGCCATGGCTCCGCGCAGCCGCACCAAGTCTGCGGCAACGGACCTCATCATTGCC
AATCTGGTGGGACAAGCAGAGGCGTCATGGAGGTACTCGTTTTACACCATTGTCCCCGACGGGATTCAATGGGGC
CAGACCATGGACAGCACCAAGTACCCGTATATTGTCGACACGGGCACCACCATGAATTACCTGCCGCCGCCGCTG
GCCGAGGCTGTGGCAATGGCCTTTGAGCCACGTGCCGTCTACATGTACCAATGGGGATCATACTTTGCCCCGTGT
GATGCCATTCCACCACGCTTCGCCGTAATCATCTCGGGCGTCGAGTTTTGGATCAATCCCGCCGATCTCTTGTAC
CAGGACCTACGGGATCCGTTGACGGGCTACTGTGCCGTGGCCATATCGAGCGGAGGGTCGGGCCCGTACATATTG
GGCGATGTGTTTTTGCAAAACGTCGTGGCGGTGTTTGATGTGGGCGGAGCACAGATGCGCTTCTACTCGCGACAC
TGA
Transcript >OphauG2|3971
ATGAGAGCATATAGCTTGGTGCCATGTGCAGTAGCGTGGTCTCTGAGTCTGGTTTTGGCTGCGCCGACCGACACT
GAGTGGGACATTTCCAAGCCACTCAACGGCATCACGTTTGAGCGGGCCAAGGCAGTACAAAGCGGCCCAACGCCA
GATGGGCCAGCGCCACGCTTTTCACGCCTTCGCAACATCAAGGGACGACCCAGCTCGCACAGTGCCGTGTCAGCC
CTGGGAAGGGTTTTGCGTGGGCAGCCGGATGGAGCGCATGAGCCCATGTGGCAAAACATTAGCAAGGCTGGCGAC
TTTACGACGCAGTATGCCATTGAGTGCGGATGGGACGGGGTGCCAGTGTGGCTTCTCTTTGACACGGGCAGCTCA
GACACTTGGGCAGTGCAAAAGGGGTTTCGATGTGACGATGGCTACGGGACCGAGGACAGCGAGGCGGCGTGTGGC
TTTGGCAAGCCGCTGATTGACGACTTTGGCAAGGGCAGCATTGAAGACTTGCACTTCTTCCTCAAGTACGGGTCA
GGGGAGCGCGTCGTGGGGCCCATGGGGCGAAGCGAGATATCGTGCGGCGGCGTCACGGTGCCCGAGCAGCAGGTG
GGACTGGCCAACTACACGTACTGGCACGGCAACAATATGACGGTGGGCGTGCTGGGGCTGGCCTATCAGTCGCTG
ACGAGCGCCTTTTACGGCGACGTTGGAAGCGAGGCGCCATGGAACGCCATGTCGTACTCGCCCTTCCTGACAAAT
GCCATTACACAGGGCTCCATGGACCCAGTCTTTAGCGTGGCGCTCGTCAAGAACTCTTCCGAGGGGATTCTGGCG
TGGGGCGGACTGCCGCCCATGGCCATGGCTCCGCGCAGCCGCACCAAGTCTGCGGCAACGGACCTCATCATTGCC
AATCTGGTGGGACAAGCAGAGGCGTCATGGAGGTACTCGTTTTACACCATTGTCCCCGACGGGATTCAATGGGGC
CAGACCATGGACAGCACCAAGTACCCGTATATTGTCGACACGGGCACCACCATGAATTACCTGCCGCCGCCGCTG
GCCGAGGCTGTGGCAATGGCCTTTGAGCCACGTGCCGTCTACATGTACCAATGGGGATCATACTTTGCCCCGTGT
GATGCCATTCCACCACGCTTCGCCGTAATCATCTCGGGCGTCGAGTTTTGGATCAATCCCGCCGATCTCTTGTAC
CAGGACCTACGGGATCCGTTGACGGGCTACTGTGCCGTGGCCATATCGAGCGGAGGGTCGGGCCCGTACATATTG
GGCGATGTGTTTTTGCAAAACGTCGTGGCGGTGTTTGATGTGGGCGGAGCACAGATGCGCTTCTACTCGCGACAC
TGA
Gene >OphauG2|3971
ATGAGAGCATATAGCTTGGTGCCATGTGCAGTAGCGTGGTCTCTGAGTCTGGTTTTGGCTGCGCCGACCGACACT
GAGTGGGACATTTCCAAGCCACTCAACGGCATCACGTTTGAGCGGGCCAAGGCAGTACAAAGCGGCCCAACGCCA
GATGGGCCAGCGCCACGCTTTTCACGCCTTCGCAACATCAAGGGACGACCCAGCTCGCACAGTGCCGTGTCAGCC
CTGGGAAGGGTTTTGCGTGGGCAGCCGGATGGAGCGCATGAGCCCATGTGGCAAAACATTAGCAAGGCTGGCGAC
TTTACGACGCAGTATGCCATTGAGTGCGGATGGGACGGGGTGCCAGTGTGGCTTCTCTTTGACACGGGCAGCTCA
GACACTTGGGCAGTGCAAAAGGGGTTTCGATGTGACGATGGCTACGGGACCGAGGACAGCGAGGCGGCGTGTGGC
TTTGGCAAGCCGCTGATTGACGACTTTGGCAAGGGCAGCATTGAAGACTTGCACTTCTTCCTCAAGTACGGGTCA
GGGGAGCGCGTCGTGGGGCCCATGGGGCGAAGCGAGATATCGTGCGGCGGCGTCACGGTGCCCGAGCAGCAGGTG
GGACTGGCCAACTACACGTACTGGCACGGCAACAATATGACGGTGGGCGTGCTGGGGCTGGCCTATCAGTCGCTG
ACGAGCGCCTTTTACGGCGACGTTGGAAGCGAGGCGCCATGGAACGCCATGTCGTACTCGCCCTTCCTGACAAAT
GCCATTACACAGGGCTCCATGGACCCAGTCTTTAGCGTGGCGCTCGTCAAGAACTCTTCCGAGGGGATTCTGGCG
TGGGGCGGACTGCCGCCCATGGCCATGGCTCCGCGCAGCCGCACCAAGTCTGCGGCAACGGACCTCATCATTGTG
AGTTGCAAGAGTTGAGTCTAGGACAACATGGCGTGGACTGACCGAGACGGGTGACATTGCGCAGGCCAATCTGGT
GGGACAAGCAGAGGCGTCATGGAGGTACTCGTTTTACACCATTGTCCCCGACGGGATTCAATGGGGCCAGACCAT
GGACAGCACCAAGTACCCGTATATTGTCGACACGGGCACCACCATGAATTACCTGCCGCCGCGTAAGTCGACTTG
GTTGGCGTCTTGTTGAAGACGCTGGGAGCAATGAGAGAGAGCTGGCTGACAAGTCACAGCGCTGGCCGAGGCTGT
GGCAATGGCCTTTGAGCCACGTGCCGTCTACATGTACCAATGGGGATCATACTTTGCCCCGTGTGATGCCATTCC
ACCACGCTTCGCCGTAATCATCTCGGGCGTCGAGTTTTGGATCAATCCCGCCGATCTCTTGTACCAGGACCTACG
GGATCCGTTGACGGGCTACTGTGCCGTGGCCATATCGAGCGGAGGGTCGGGCCCGTACATATTGGGCGATGTGTT
TTTGCAAAACGTCGTGGCGGTGTTTGATGTGGGCGGAGCACAGATGCGCTTCTACTCGCGACACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail