Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|3967
Gene name
LocationContig_314:9404..11286
Strand+
Gene length (bp)1882
Transcript length (bp)1695
Coding sequence length (bp)1695
Protein length (aa) 565

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00013 KH_1 KH domain 5.2E-13 190 253
PF00013 KH_1 KH domain 3.9E-15 288 352
PF00013 KH_1 KH domain 1.1E-14 401 463

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q99PF5|FUBP2_RAT Far upstream element-binding protein 2 OS=Rattus norvegicus GN=Khsrp PE=1 SV=1 189 469 6.0E-27
sp|Q3U0V1|FUBP2_MOUSE Far upstream element-binding protein 2 OS=Mus musculus GN=Khsrp PE=1 SV=2 189 469 7.0E-27
sp|Q8UVD9|FUBP2_CHICK Far upstream element-binding protein 2 OS=Gallus gallus GN=KHSRP PE=1 SV=1 189 469 7.0E-26
sp|Q96I24|FUBP3_HUMAN Far upstream element-binding protein 3 OS=Homo sapiens GN=FUBP3 PE=1 SV=2 189 473 1.0E-24
sp|Q92945|FUBP2_HUMAN Far upstream element-binding protein 2 OS=Homo sapiens GN=KHSRP PE=1 SV=4 93 469 3.0E-23
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q99PF5|FUBP2_RAT Far upstream element-binding protein 2 OS=Rattus norvegicus GN=Khsrp PE=1 SV=1 189 469 6.0E-27
sp|Q3U0V1|FUBP2_MOUSE Far upstream element-binding protein 2 OS=Mus musculus GN=Khsrp PE=1 SV=2 189 469 7.0E-27
sp|Q8UVD9|FUBP2_CHICK Far upstream element-binding protein 2 OS=Gallus gallus GN=KHSRP PE=1 SV=1 189 469 7.0E-26
sp|Q96I24|FUBP3_HUMAN Far upstream element-binding protein 3 OS=Homo sapiens GN=FUBP3 PE=1 SV=2 189 473 1.0E-24
sp|Q92945|FUBP2_HUMAN Far upstream element-binding protein 2 OS=Homo sapiens GN=KHSRP PE=1 SV=4 93 469 3.0E-23
sp|Q96AE4|FUBP1_HUMAN Far upstream element-binding protein 1 OS=Homo sapiens GN=FUBP1 PE=1 SV=3 189 469 4.0E-23
sp|Q91WJ8|FUBP1_MOUSE Far upstream element-binding protein 1 OS=Mus musculus GN=Fubp1 PE=1 SV=1 189 437 1.0E-22
sp|Q32PX7|FUBP1_RAT Far upstream element-binding protein 1 OS=Rattus norvegicus GN=Fubp1 PE=1 SV=1 189 437 1.0E-22
sp|Q96I24|FUBP3_HUMAN Far upstream element-binding protein 3 OS=Homo sapiens GN=FUBP3 PE=1 SV=2 186 465 1.0E-12
sp|Q9LZ82|BTR1_ARATH Protein BTR1 OS=Arabidopsis thaliana GN=BTR1 PE=1 SV=1 200 472 2.0E-11
sp|Q96AE4|FUBP1_HUMAN Far upstream element-binding protein 1 OS=Homo sapiens GN=FUBP1 PE=1 SV=3 190 465 4.0E-11
sp|Q91WJ8|FUBP1_MOUSE Far upstream element-binding protein 1 OS=Mus musculus GN=Fubp1 PE=1 SV=1 190 465 6.0E-11
sp|Q0VCU0|PCBP4_BOVIN Poly(rC)-binding protein 4 OS=Bos taurus GN=PCBP4 PE=2 SV=1 199 477 2.0E-10
sp|Q32PX7|FUBP1_RAT Far upstream element-binding protein 1 OS=Rattus norvegicus GN=Fubp1 PE=1 SV=1 190 465 2.0E-10
sp|P57724|PCBP4_MOUSE Poly(rC)-binding protein 4 OS=Mus musculus GN=Pcbp4 PE=1 SV=1 199 477 3.0E-10
sp|Q9Y2W6|TDRKH_HUMAN Tudor and KH domain-containing protein OS=Homo sapiens GN=TDRKH PE=1 SV=2 184 357 5.0E-10
sp|P57723|PCBP4_HUMAN Poly(rC)-binding protein 4 OS=Homo sapiens GN=PCBP4 PE=2 SV=1 199 474 8.0E-10
sp|Q80VL1|TDRKH_MOUSE Tudor and KH domain-containing protein OS=Mus musculus GN=Tdrkh PE=1 SV=1 192 357 1.0E-09
sp|Q96AE4|FUBP1_HUMAN Far upstream element-binding protein 1 OS=Homo sapiens GN=FUBP1 PE=1 SV=3 199 360 2.0E-09
sp|Q9Y2W6|TDRKH_HUMAN Tudor and KH domain-containing protein OS=Homo sapiens GN=TDRKH PE=1 SV=2 284 471 2.0E-09
sp|Q91WJ8|FUBP1_MOUSE Far upstream element-binding protein 1 OS=Mus musculus GN=Fubp1 PE=1 SV=1 199 360 5.0E-09
sp|Q32PX7|FUBP1_RAT Far upstream element-binding protein 1 OS=Rattus norvegicus GN=Fubp1 PE=1 SV=1 199 360 5.0E-09
sp|Q8UVD9|FUBP2_CHICK Far upstream element-binding protein 2 OS=Gallus gallus GN=KHSRP PE=1 SV=1 184 466 5.0E-09
sp|Q2PFW9|NOVA1_MACFA RNA-binding protein Nova-1 OS=Macaca fascicularis GN=NOVA1 PE=2 SV=1 162 357 3.0E-08
sp|Q80WA4|NOVA1_RAT RNA-binding protein Nova-1 (Fragment) OS=Rattus norvegicus GN=Nova1 PE=2 SV=1 162 357 4.0E-08
sp|Q3U0V1|FUBP2_MOUSE Far upstream element-binding protein 2 OS=Mus musculus GN=Khsrp PE=1 SV=2 184 466 6.0E-08
sp|Q99PF5|FUBP2_RAT Far upstream element-binding protein 2 OS=Rattus norvegicus GN=Khsrp PE=1 SV=1 184 466 9.0E-08
sp|Q92945|FUBP2_HUMAN Far upstream element-binding protein 2 OS=Homo sapiens GN=KHSRP PE=1 SV=4 184 466 1.0E-07
sp|Q96I24|FUBP3_HUMAN Far upstream element-binding protein 3 OS=Homo sapiens GN=FUBP3 PE=1 SV=2 177 321 2.0E-07
sp|Q9SR13|FLK_ARATH Flowering locus K homology domain OS=Arabidopsis thaliana GN=FLK PE=1 SV=1 194 350 2.0E-07
sp|Q9JKN6|NOVA1_MOUSE RNA-binding protein Nova-1 OS=Mus musculus GN=Nova1 PE=1 SV=2 162 357 4.0E-07
sp|Q5RB68|IF2B2_PONAB Insulin-like growth factor 2 mRNA-binding protein 2 OS=Pongo abelii GN=IGF2BP2 PE=2 SV=1 192 449 1.0E-06
sp|Q61990|PCBP2_MOUSE Poly(rC)-binding protein 2 OS=Mus musculus GN=Pcbp2 PE=1 SV=1 288 470 1.0E-06
sp|Q15366|PCBP2_HUMAN Poly(rC)-binding protein 2 OS=Homo sapiens GN=PCBP2 PE=1 SV=1 288 470 1.0E-06
sp|P51513|NOVA1_HUMAN RNA-binding protein Nova-1 OS=Homo sapiens GN=NOVA1 PE=1 SV=1 162 357 1.0E-06
sp|O19048|PCBP1_RABIT Poly(rC)-binding protein 1 OS=Oryctolagus cuniculus GN=PCBP1 PE=2 SV=1 288 457 5.0E-06
sp|P60335|PCBP1_MOUSE Poly(rC)-binding protein 1 OS=Mus musculus GN=Pcbp1 PE=1 SV=1 288 457 5.0E-06
sp|Q15365|PCBP1_HUMAN Poly(rC)-binding protein 1 OS=Homo sapiens GN=PCBP1 PE=1 SV=2 288 457 5.0E-06
sp|Q5E9A3|PCBP1_BOVIN Poly(rC)-binding protein 1 OS=Bos taurus GN=PCBP1 PE=2 SV=1 288 457 5.0E-06
sp|P57721|PCBP3_HUMAN Poly(rC)-binding protein 3 OS=Homo sapiens GN=PCBP3 PE=2 SV=2 199 360 9.0E-06
sp|P57722|PCBP3_MOUSE Poly(rC)-binding protein 3 OS=Mus musculus GN=Pcbp3 PE=1 SV=3 199 360 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:0003674 molecular_function No
GO:1901363 heterocyclic compound binding No
GO:0005488 binding No
GO:0003676 nucleic acid binding No
GO:0097159 organic cyclic compound binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 13 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|3967
MAEPQPDIQSILAALASQRGPTQTPSQQPPGASAPAYPAPSASAPPPGSYPHPPPPGLPSYGGPAHHGLPAPASS
GNVDLSALRPVNSGTLNFEDIMSQARAYAAGKGATPYDRPLTYNADPRSAERSYRTSRSRSPRTDYHRDERRGGH
GREHGRDRSYSPPPRGRPFSPRAGSTRDRSPLRGADENSETIQIEASLVGLIIGRQGENLRRIESESNCRVQFLA
ATDGGPFRQCRISGPRQRRAEVKAAIDRIIEDSGMGPLNRVPDKSRDTNRAGTAGLRDGEDHIQIMVPDRTVGLI
IGRGGETIRDLQERSGCHINIVGESKSVNGLRPVNLIGTVEATSRAKDFIMEIVDSDTRGDGPAGKKAVATVTVG
GGISGHADIPSSVREAGGNDKINDAIYVPSDAVGMIIGRGGETIREMQNATGCKINVAQSSGPGEVQREIALIGA
RDSIARAKMAIEEKVEAVRQKSGGGGGGSGGGGGGRGRGYQDVDRGPGGSYAQQSANASATANQTPQASTGDGPD
PYAQYGGYQNYLALWYQSLMYQQQQQQQQGGQGAPAPGA*
Coding >OphauG2|3967
ATGGCAGAGCCTCAACCAGATATCCAATCCATTCTTGCTGCACTTGCATCCCAGCGTGGCCCAACGCAGACGCCA
AGCCAGCAGCCTCCCGGCGCATCGGCACCTGCATACCCTGCTCCATCTGCTTCAGCGCCACCGCCTGGCTCCTAC
CCCCACCCTCCGCCCCCTGGCCTGCCTTCGTATGGCGGCCCAGCCCATCATGGCTTACCTGCCCCGGCTTCAAGC
GGCAATGTCGACTTGAGCGCCCTTCGTCCTGTAAACTCGGGGACCCTAAACTTTGAAGACATCATGTCACAAGCA
CGAGCCTACGCAGCCGGAAAAGGAGCCACTCCATACGATCGCCCCCTCACCTATAATGCCGATCCTCGAAGCGCG
GAGCGATCCTACCGGACCTCAAGATCCCGATCCCCCCGGACAGATTACCACAGAGACGAACGTCGCGGTGGTCAC
GGTCGCGAACACGGCCGCGATCGATCATATTCTCCTCCGCCCCGCGGTCGCCCCTTTTCGCCCCGCGCGGGGAGC
ACCCGGGATAGATCACCTCTGCGAGGCGCTGACGAGAACTCGGAGACAATTCAAATCGAGGCCAGCCTCGTCGGC
CTAATTATTGGTCGCCAAGGCGAGAACCTTCGACGCATTGAATCCGAGTCCAACTGTAGGGTGCAGTTTCTTGCT
GCCACAGACGGAGGTCCTTTTAGACAATGCAGAATATCTGGACCGCGGCAACGTCGTGCCGAGGTCAAGGCAGCC
ATTGATCGTATCATTGAGGATAGTGGCATGGGTCCCCTGAACCGAGTGCCAGACAAGTCACGAGACACCAATAGG
GCAGGCACAGCTGGCCTCCGAGACGGCGAAGATCACATTCAAATTATGGTGCCAGATCGCACTGTTGGCCTAATC
ATCGGTCGTGGAGGTGAAACTATTCGAGACCTCCAAGAACGTTCAGGATGTCACATAAACATTGTTGGAGAGTCC
AAAAGTGTCAATGGCCTCCGACCAGTAAATCTAATAGGCACCGTCGAAGCTACATCTCGTGCCAAGGACTTCATC
ATGGAGATTGTCGATAGTGATACAAGAGGAGATGGTCCTGCTGGAAAGAAGGCGGTTGCCACCGTCACCGTTGGC
GGTGGAATAAGCGGGCACGCCGACATACCTAGTTCCGTGAGGGAAGCCGGCGGAAACGACAAGATCAATGATGCC
ATATATGTTCCTTCAGATGCTGTTGGAATGATTATTGGAAGAGGTGGCGAAACTATTCGCGAGATGCAAAACGCC
ACAGGGTGCAAAATCAACGTGGCCCAGTCCTCAGGCCCAGGAGAAGTGCAGAGAGAGATTGCTCTTATTGGTGCA
CGCGATAGTATAGCTCGCGCTAAAATGGCCATCGAGGAAAAGGTTGAAGCAGTGCGCCAGAAAAGCGGTGGCGGC
GGCGGCGGCAGCGGCGGCGGCGGTGGTGGTCGTGGACGGGGCTACCAAGACGTGGACCGAGGTCCTGGCGGTTCA
TATGCGCAACAAAGCGCCAATGCGTCTGCCACAGCTAACCAGACGCCTCAGGCGTCGACAGGTGATGGCCCTGAT
CCGTATGCACAATACGGCGGATACCAGAACTATCTTGCTCTCTGGTACCAGTCATTAATGTACCAGCAACAGCAG
CAGCAACAGCAAGGCGGACAAGGGGCACCCGCTCCTGGGGCCTAG
Transcript >OphauG2|3967
ATGGCAGAGCCTCAACCAGATATCCAATCCATTCTTGCTGCACTTGCATCCCAGCGTGGCCCAACGCAGACGCCA
AGCCAGCAGCCTCCCGGCGCATCGGCACCTGCATACCCTGCTCCATCTGCTTCAGCGCCACCGCCTGGCTCCTAC
CCCCACCCTCCGCCCCCTGGCCTGCCTTCGTATGGCGGCCCAGCCCATCATGGCTTACCTGCCCCGGCTTCAAGC
GGCAATGTCGACTTGAGCGCCCTTCGTCCTGTAAACTCGGGGACCCTAAACTTTGAAGACATCATGTCACAAGCA
CGAGCCTACGCAGCCGGAAAAGGAGCCACTCCATACGATCGCCCCCTCACCTATAATGCCGATCCTCGAAGCGCG
GAGCGATCCTACCGGACCTCAAGATCCCGATCCCCCCGGACAGATTACCACAGAGACGAACGTCGCGGTGGTCAC
GGTCGCGAACACGGCCGCGATCGATCATATTCTCCTCCGCCCCGCGGTCGCCCCTTTTCGCCCCGCGCGGGGAGC
ACCCGGGATAGATCACCTCTGCGAGGCGCTGACGAGAACTCGGAGACAATTCAAATCGAGGCCAGCCTCGTCGGC
CTAATTATTGGTCGCCAAGGCGAGAACCTTCGACGCATTGAATCCGAGTCCAACTGTAGGGTGCAGTTTCTTGCT
GCCACAGACGGAGGTCCTTTTAGACAATGCAGAATATCTGGACCGCGGCAACGTCGTGCCGAGGTCAAGGCAGCC
ATTGATCGTATCATTGAGGATAGTGGCATGGGTCCCCTGAACCGAGTGCCAGACAAGTCACGAGACACCAATAGG
GCAGGCACAGCTGGCCTCCGAGACGGCGAAGATCACATTCAAATTATGGTGCCAGATCGCACTGTTGGCCTAATC
ATCGGTCGTGGAGGTGAAACTATTCGAGACCTCCAAGAACGTTCAGGATGTCACATAAACATTGTTGGAGAGTCC
AAAAGTGTCAATGGCCTCCGACCAGTAAATCTAATAGGCACCGTCGAAGCTACATCTCGTGCCAAGGACTTCATC
ATGGAGATTGTCGATAGTGATACAAGAGGAGATGGTCCTGCTGGAAAGAAGGCGGTTGCCACCGTCACCGTTGGC
GGTGGAATAAGCGGGCACGCCGACATACCTAGTTCCGTGAGGGAAGCCGGCGGAAACGACAAGATCAATGATGCC
ATATATGTTCCTTCAGATGCTGTTGGAATGATTATTGGAAGAGGTGGCGAAACTATTCGCGAGATGCAAAACGCC
ACAGGGTGCAAAATCAACGTGGCCCAGTCCTCAGGCCCAGGAGAAGTGCAGAGAGAGATTGCTCTTATTGGTGCA
CGCGATAGTATAGCTCGCGCTAAAATGGCCATCGAGGAAAAGGTTGAAGCAGTGCGCCAGAAAAGCGGTGGCGGC
GGCGGCGGCAGCGGCGGCGGCGGTGGTGGTCGTGGACGGGGCTACCAAGACGTGGACCGAGGTCCTGGCGGTTCA
TATGCGCAACAAAGCGCCAATGCGTCTGCCACAGCTAACCAGACGCCTCAGGCGTCGACAGGTGATGGCCCTGAT
CCGTATGCACAATACGGCGGATACCAGAACTATCTTGCTCTCTGGTACCAGTCATTAATGTACCAGCAACAGCAG
CAGCAACAGCAAGGCGGACAAGGGGCACCCGCTCCTGGGGCCTAG
Gene >OphauG2|3967
ATGGCAGAGCCTCAACCAGATATCCAATCCATTCTTGCTGCACTTGGTGAGTATTCACGCTCTGCTTATCGACGC
TCAGCATGAGTTGACCCCACTTCATATCCAGCATCCCAGCGTGGCCCAACGCAGACGCCAAGCCAGCAGCCTCCC
GGCGCATCGGCACCTGCATACCCTGCTCCATCTGCTTCAGCGCCACCGCCTGGCTCCTACCCCCACCCTCCGCCC
CCTGGCCTGCCTTCGTATGGCGGCCCAGCCCATCATGGCTTACCTGCCCCGGCTTCAAGCGGCAATGTCGACTTG
AGCGCCCTTCGTCCTGTAAACTCGGGGACCCTAAACTTTGAAGACATCATGTCACAAGCACGAGCCTACGCAGCC
GGAAAAGGAGCCACTCCATACGATCGCCCCCTCACCTATAATGCCGATCCTCGAAGCGCGGAGCGATCCTACCGG
ACCTCAAGATCCCGATCCCCCCGGACAGATTACCACAGAGACGAACGTCGCGGTGGTCACGGTCGCGAACACGGC
CGCGATCGATCATATTCTCCTCCGCCCCGCGGTCGCCCCTTTTCGCCCCGCGCGGGGAGCACCCGGGATAGATCA
CCTCTGCGAGGCGCTGACGAGAACTCGGAGACAATTCAAATCGAGGCCAGCCTCGTCGGCCTAATTATTGGTCGC
CAAGGCGAGAACCTTCGACGCATTGAATCCGAGTCCAACTGTAGGGTGCAGTTTCTTGCTGCCACAGACGGAGGT
CCTTTTAGACAATGCAGAATATCTGGACCGCGGCAACGTCGTGCCGAGGTCAAGGCAGCCATTGATCGTATCATT
GAGGATAGTGGCATGGGTCCCCTGAACCGAGTGCCAGACAAGTCACGAGACACCAATAGGGCAGGCACAGCTGGC
CTCCGAGACGGCGAAGATCACATTCAAATTATGGTGCCAGATCGCACTGTTGGCCTAATCATCGGTCGTGGAGGT
GAAACTATTCGAGACCTCCAAGAACGTTCAGGATGTCACATAAACATTGTTGGAGAGTCCAAAAGTGTCAATGGC
CTCCGACCAGTAAATCTAATAGGCACCGTCGAAGCTACATCTCGTGCCAAGGACTTCATCATGGAGATTGTCGAT
AGTGATACAAGAGGAGATGGTCCTGCTGGAAAGAAGGCGGTTGCCACCGTCACCGTTGGCGGTGGAATAAGCGGG
CACGCCGACATACCTAGTTCCGTGAGGGAAGCCGGCGGAAACGACAAGATCAATGATGCCATATATGTTCCTTCA
GATGCTGTTGGAATGATTATTGGAAGAGGTGGCGAAACTATTCGCGAGATGCAAAACGCCACAGGGTGCAAAATC
AACGTGGCCCAGTCCTCAGGCCCAGGAGAAGTGCAGAGAGAGATTGCTCTTATTGGTGCACGCGATAGTATAGCT
CGCGCTAAAATGGCCATCGAGGAAAAGGTTGAAGCAGTGGTACGTCAAGTTGTCATGGCATTTACGCGAGGACCT
TGTCTGTAGAGTTTGCTGACTGACAAACCTGCAGCGCCAGAAAAGCGGTGGCGGCGGCGGCGGCAGCGGCGGCGG
CGGTGGTGGTCGTGGACGGGGCTACCAAGACGTGGACCGAGGTCCTGGCGGTTCATATGCGCAACAAAGCGCCAA
TGCGTCTGCCACAGCTAACCAGACGCCTCAGGCGTCGACAGGTGATGGCCCTGATCCGTATGCACAATGTGAGTG
ACGGCCATGACATGATGGACCGGAATGGGCAAGCTGACACGAAATTGCAGACGGCGGATACCAGAACTATCTTGC
TCTCTGGTACCAGTCATTAATGTACCAGCAACAGCAGCAGCAACAGCAAGGCGGACAAGGGGCACCCGCTCCTGG
GGCCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail