Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|396
Gene name
LocationContig_109:27930..28282
Strand+
Gene length (bp)352
Transcript length (bp)294
Coding sequence length (bp)294
Protein length (aa) 98

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q8WZY3|YBG3_NEUCR Uncharacterized protein B24G3.190 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=B24G3.190 PE=3 SV=1 1 95 8.0E-18
sp|P0CT04|IPB2_YEAST Protease B inhibitor 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PBI2 PE=1 SV=1 35 96 7.0E-07

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|396
MKIFALFATALALAASAWAAGPKKSAIIWFEDAKTPDSVVQQAKDSVVKAGGKITHEYTLIRGFSVVAPEEALQM
MQASNKNNGMRIEEDRMVSTDE*
Coding >OphauG2|396
ATGAAGATATTTGCTCTCTTTGCTACGGCGCTGGCACTTGCAGCCTCGGCTTGGGCTGCCGGTCCAAAAAAGTCT
GCCATTATCTGGTTTGAGGATGCCAAAACGCCCGACTCGGTCGTCCAGCAGGCCAAGGACTCAGTGGTCAAGGCT
GGTGGCAAGATTACTCACGAGTACACGCTCATCAGAGGCTTTTCCGTCGTGGCACCCGAGGAGGCCCTTCAGATG
ATGCAGGCTTCCAACAAGAACAATGGAATGCGAATTGAAGAGGATCGGATGGTGTCCACAGACGAATGA
Transcript >OphauG2|396
ATGAAGATATTTGCTCTCTTTGCTACGGCGCTGGCACTTGCAGCCTCGGCTTGGGCTGCCGGTCCAAAAAAGTCT
GCCATTATCTGGTTTGAGGATGCCAAAACGCCCGACTCGGTCGTCCAGCAGGCCAAGGACTCAGTGGTCAAGGCT
GGTGGCAAGATTACTCACGAGTACACGCTCATCAGAGGCTTTTCCGTCGTGGCACCCGAGGAGGCCCTTCAGATG
ATGCAGGCTTCCAACAAGAACAATGGAATGCGAATTGAAGAGGATCGGATGGTGTCCACAGACGAATGA
Gene >OphauG2|396
ATGAAGATATTTGCTCTCTTTGCTACGGCGCTGGCACTTGCAGCCTCGGCTTGGGCTGCCGGTCCAAAAAAGTCT
GCCATTATCTGGTTTGAGGATGCCAAAACGCCCGACTCGGTCGTCCAGCAGGCCAAGGACTCAGTGGTCAAGGCT
GGTGGCAAGATTACTCACGAGTACACGCTCATCAGGTGTGTATATTCCACCCTTGGCTGCTACTGAGATTGTGTT
TTGTAACCCTTGCGATAGAGGCTTTTCCGTCGTGGCACCCGAGGAGGCCCTTCAGATGATGCAGGCTTCCAACAA
GAACAATGGAATGCGAATTGAAGAGGATCGGATGGTGTCCACAGACGAATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail