Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|3956
Gene name
LocationContig_312:15969..17181
Strand+
Gene length (bp)1212
Transcript length (bp)1050
Coding sequence length (bp)1050
Protein length (aa) 350

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00891 Methyltransf_2 O-methyltransferase domain 1.8E-16 180 320

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UQY0|OMTB_ASPPA Demethylsterigmatocystin 6-O-methyltransferase OS=Aspergillus parasiticus GN=omtB PE=1 SV=2 8 340 2.0E-45
sp|Q9P900|OMTB_ASPFL Demethylsterigmatocystin 6-O-methyltransferase OS=Aspergillus flavus GN=omtB PE=3 SV=1 8 340 2.0E-44
sp|Q12120|OMTA_ASPPA Sterigmatocystin 8-O-methyltransferase OS=Aspergillus parasiticus GN=omtA PE=1 SV=1 26 337 4.0E-27
sp|P55790|OMTA_ASPFL Sterigmatocystin 8-O-methyltransferase OS=Aspergillus flavus GN=omtA PE=3 SV=1 41 337 1.0E-25
sp|Q4WAW6|FTMD_ASPFU 6-hydroxytryprostatin B O-methyltransferase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ftmMT PE=1 SV=1 182 343 3.0E-18
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UQY0|OMTB_ASPPA Demethylsterigmatocystin 6-O-methyltransferase OS=Aspergillus parasiticus GN=omtB PE=1 SV=2 8 340 2.0E-45
sp|Q9P900|OMTB_ASPFL Demethylsterigmatocystin 6-O-methyltransferase OS=Aspergillus flavus GN=omtB PE=3 SV=1 8 340 2.0E-44
sp|Q12120|OMTA_ASPPA Sterigmatocystin 8-O-methyltransferase OS=Aspergillus parasiticus GN=omtA PE=1 SV=1 26 337 4.0E-27
sp|P55790|OMTA_ASPFL Sterigmatocystin 8-O-methyltransferase OS=Aspergillus flavus GN=omtA PE=3 SV=1 41 337 1.0E-25
sp|Q4WAW6|FTMD_ASPFU 6-hydroxytryprostatin B O-methyltransferase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ftmMT PE=1 SV=1 182 343 3.0E-18
sp|B9WZX2|FTMD_ASPFM 6-hydroxytryprostatin B O-methyltransferase OS=Neosartorya fumigata GN=ftmMT PE=1 SV=1 182 343 2.0E-17
sp|A1DA61|FTMD_NEOFI 6-hydroxytryprostatin B O-methyltransferase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=ftmMT PE=3 SV=1 182 319 2.0E-13
sp|Q54B59|OMT12_DICDI O-methyltransferase 12 OS=Dictyostelium discoideum GN=omt12 PE=1 SV=1 167 335 3.0E-13
sp|Q8GSN1|MOMT_CATRO Myricetin O-methyltransferase OS=Catharanthus roseus PE=1 SV=1 33 330 9.0E-12
sp|Q7XB10|4OMT2_PAPSO 3'-hydroxy-N-methyl-(S)-coclaurine 4'-O-methyltransferase 2 OS=Papaver somniferum GN=4'OMT2 PE=1 SV=1 182 341 1.0E-11
sp|Q54GZ0|OMT9_DICDI O-methyltransferase 9 OS=Dictyostelium discoideum GN=omt9 PE=3 SV=1 182 319 5.0E-11
sp|P42712|DMPM_STRAD O-demethylpuromycin-O-methyltransferase OS=Streptomyces alboniger GN=dmpM PE=3 SV=1 39 318 6.0E-10
sp|C7SDN9|N7OMT_PAPSO Norreticuline-7-O-methyltransferase OS=Papaver somniferum PE=1 SV=1 178 341 6.0E-10
sp|Q6WUC1|6OMT_PAPSO (RS)-norcoclaurine 6-O-methyltransferase OS=Papaver somniferum GN=6OMT PE=1 SV=1 182 341 3.0E-09
sp|B0EXJ8|HTOMT_CATRO Tabersonine 16-O-methyltransferase OS=Catharanthus roseus GN=16OMT PE=1 SV=1 46 341 4.0E-09
sp|Q9LEL5|4OMT_COPJA 3'-hydroxy-N-methyl-(S)-coclaurine 4'-O-methyltransferase OS=Coptis japonica PE=1 SV=1 182 329 5.0E-09
sp|P16559|TCMN_STRGA Multifunctional cyclase-dehydratase-3-O-methyl transferase TcmN OS=Streptomyces glaucescens GN=tcmN PE=1 SV=2 182 318 8.0E-09
sp|P93324|CHOMT_MEDSA Isoliquiritigenin 2'-O-methyltransferase OS=Medicago sativa PE=1 SV=1 182 317 1.0E-08
sp|Q6WUC2|7OMT_PAPSO (R,S)-reticuline 7-O-methyltransferase OS=Papaver somniferum GN=7OMT PE=1 SV=1 182 328 2.0E-08
sp|Q54S95|OMT7_DICDI O-methyltransferase 7 OS=Dictyostelium discoideum GN=omt7 PE=3 SV=1 182 319 3.0E-08
sp|Q6T1F6|BMT_AMMMJ Bergaptol O-methyltransferase OS=Ammi majus GN=BMT PE=1 SV=1 35 324 4.0E-08
sp|A8J6X1|BMT_GLELI Bergaptol O-methyltransferase OS=Glehnia littoralis GN=BMT PE=1 SV=1 35 324 6.0E-08
sp|Q38J50|FOMT2_WHEAT Tricetin 3',4',5'-O-trimethyltransferase OS=Triticum aestivum GN=OMT2 PE=1 SV=1 182 328 5.0E-07
sp|Q92056|ASMT_CHICK Acetylserotonin O-methyltransferase OS=Gallus gallus GN=ASMT PE=2 SV=1 200 318 1.0E-06
sp|D5AP78|CRTF_RHOCB Demethylspheroidene O-methyltransferase OS=Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003) GN=crtF PE=1 SV=1 178 343 2.0E-06
sp|D3KU66|ASMT_MOUSE Acetylserotonin O-methyltransferase OS=Mus musculus GN=Asmt PE=2 SV=1 168 324 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0008171 O-methyltransferase activity Yes
GO:0003674 molecular_function No
GO:0016740 transferase activity No
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0003824 catalytic activity No
GO:0008168 methyltransferase activity No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup30
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7767
Ophiocordyceps australis 1348a (Ghana) OphauG2|7346
Ophiocordyceps australis 1348a (Ghana) OphauG2|7110
Ophiocordyceps australis 1348a (Ghana) OphauG2|4885
Ophiocordyceps australis 1348a (Ghana) OphauG2|4306
Ophiocordyceps australis 1348a (Ghana) OphauG2|3956 (this protein)
Ophiocordyceps australis 1348a (Ghana) OphauG2|1539
Ophiocordyceps australis 1348a (Ghana) OphauG2|1895
Ophiocordyceps australis 1348a (Ghana) OphauG2|266
Ophiocordyceps australis map64 (Brazil) OphauB2|758
Ophiocordyceps australis map64 (Brazil) OphauB2|1462
Ophiocordyceps australis map64 (Brazil) OphauB2|2012
Ophiocordyceps australis map64 (Brazil) OphauB2|4017
Ophiocordyceps australis map64 (Brazil) OphauB2|4564
Ophiocordyceps australis map64 (Brazil) OphauB2|7299
Ophiocordyceps camponoti-rufipedis Ophun1|2861
Ophiocordyceps camponoti-rufipedis Ophun1|2000
Ophiocordyceps subramaniannii Hirsu2|8115
Ophiocordyceps subramaniannii Hirsu2|7926
Ophiocordyceps subramaniannii Hirsu2|6259
Ophiocordyceps subramaniannii Hirsu2|2878
Ophiocordyceps subramaniannii Hirsu2|1201
Ophiocordyceps subramaniannii Hirsu2|11082

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|3956
MSWQTGAIAGLNFGVDSGLWILMSKNGDMSQKVGDLAANLGIDPVLLSRLMRHLGAMGYLIETGEDEYRLTNYTK
AMSIPAIGNSYLAMLSCGSSGAARFHEFSRKRGWANPTDAKDTALMYAYGTKLDIFEWQQSLGYGTHFIDHISGY
DLGRLPWMAPGFYPVKERLITGADADPEAPFLVDIAGNVGHDLARFYKCYPSVPGKLILEDLPSVINTIQDLDPA
IIRIGYDFHTKQPIQGARAYYMRNILHNWPDKVCDDILAQVKTAMKPGYSRLLINEYVIPETGAYWEATALDMVM
LTLMSAHERTRAAWYNLLETRAGLCIVKIWSGEKSSQSLIECELREGGK*
Coding >OphauG2|3956
ATGAGCTGGCAGACTGGTGCAATTGCTGGTCTCAATTTTGGCGTGGATTCGGGTTTGTGGATATTAATGTCGAAG
AATGGCGACATGTCTCAAAAAGTCGGCGACTTGGCAGCAAATCTTGGGATTGATCCTGTTCTTTTAAGTCGTCTA
ATGCGACACCTTGGTGCCATGGGATATCTCATCGAGACTGGAGAAGATGAATACAGGTTGACGAATTACACCAAA
GCAATGAGCATTCCTGCCATTGGCAACAGTTATCTTGCCATGCTCTCGTGTGGAAGTTCTGGCGCTGCAAGATTC
CACGAATTCTCTCGAAAACGGGGCTGGGCAAATCCCACGGATGCTAAAGACACGGCACTAATGTACGCCTATGGA
ACGAAACTAGATATTTTTGAGTGGCAGCAGTCCCTAGGCTATGGGACACATTTCATTGATCACATCAGCGGCTAC
GACCTTGGCCGCTTGCCGTGGATGGCTCCTGGCTTTTATCCAGTAAAAGAGAGGCTGATTACCGGCGCCGATGCC
GACCCAGAGGCTCCTTTTCTCGTTGATATTGCCGGCAACGTGGGGCATGACTTGGCACGGTTCTACAAGTGCTAT
CCCAGCGTCCCGGGGAAATTAATTCTCGAGGATTTACCTAGCGTCATTAACACAATCCAGGACCTTGATCCAGCC
ATTATCCGTATAGGGTACGACTTTCATACCAAACAGCCTATTCAAGGAGCTCGAGCCTATTATATGCGGAATATT
TTGCACAACTGGCCGGATAAAGTATGCGATGATATTCTGGCCCAAGTCAAAACAGCAATGAAGCCTGGATATAGC
AGGCTACTCATCAACGAATACGTTATACCAGAGACTGGCGCCTACTGGGAAGCGACAGCACTTGACATGGTCATG
TTGACGCTCATGTCTGCTCACGAACGCACTCGCGCGGCTTGGTATAATCTTCTCGAGACGAGGGCCGGTCTTTGT
ATCGTGAAGATTTGGAGCGGTGAGAAGAGCTCGCAGAGTTTAATCGAGTGTGAGCTCCGCGAGGGTGGAAAATGA
Transcript >OphauG2|3956
ATGAGCTGGCAGACTGGTGCAATTGCTGGTCTCAATTTTGGCGTGGATTCGGGTTTGTGGATATTAATGTCGAAG
AATGGCGACATGTCTCAAAAAGTCGGCGACTTGGCAGCAAATCTTGGGATTGATCCTGTTCTTTTAAGTCGTCTA
ATGCGACACCTTGGTGCCATGGGATATCTCATCGAGACTGGAGAAGATGAATACAGGTTGACGAATTACACCAAA
GCAATGAGCATTCCTGCCATTGGCAACAGTTATCTTGCCATGCTCTCGTGTGGAAGTTCTGGCGCTGCAAGATTC
CACGAATTCTCTCGAAAACGGGGCTGGGCAAATCCCACGGATGCTAAAGACACGGCACTAATGTACGCCTATGGA
ACGAAACTAGATATTTTTGAGTGGCAGCAGTCCCTAGGCTATGGGACACATTTCATTGATCACATCAGCGGCTAC
GACCTTGGCCGCTTGCCGTGGATGGCTCCTGGCTTTTATCCAGTAAAAGAGAGGCTGATTACCGGCGCCGATGCC
GACCCAGAGGCTCCTTTTCTCGTTGATATTGCCGGCAACGTGGGGCATGACTTGGCACGGTTCTACAAGTGCTAT
CCCAGCGTCCCGGGGAAATTAATTCTCGAGGATTTACCTAGCGTCATTAACACAATCCAGGACCTTGATCCAGCC
ATTATCCGTATAGGGTACGACTTTCATACCAAACAGCCTATTCAAGGAGCTCGAGCCTATTATATGCGGAATATT
TTGCACAACTGGCCGGATAAAGTATGCGATGATATTCTGGCCCAAGTCAAAACAGCAATGAAGCCTGGATATAGC
AGGCTACTCATCAACGAATACGTTATACCAGAGACTGGCGCCTACTGGGAAGCGACAGCACTTGACATGGTCATG
TTGACGCTCATGTCTGCTCACGAACGCACTCGCGCGGCTTGGTATAATCTTCTCGAGACGAGGGCCGGTCTTTGT
ATCGTGAAGATTTGGAGCGGTGAGAAGAGCTCGCAGAGTTTAATCGAGTGTGAGCTCCGCGAGGGTGGAAAATGA
Gene >OphauG2|3956
ATGAGCTGGCAGACTGGTGCAATTGCTGGTCTCAATTTTGGCGTGGATTCGGGTTTGTGGATATTAATGTCGAAG
AATGGCGACATGTCTCAAAAAGTCGGCGACTTGGCAGCAAATCTTGGGATTGATCCTGTTCTTTTAAGTAGGTTT
TGACGCCACTTTACAAGACCAATCTCGCTAACAGTCCACTAGGTCGTCTAATGCGACACCTTGGTGCCATGGGAT
ATCTCATCGAGACTGGAGAAGATGAATACAGGTTGACGAATTACACCAAAGCAATGAGCATTCCTGCCATTGGCA
ACAGTTATCTTGCCATGTAAGCTCAATCTCCCGGAGATAAAGTTGCTGCTCACATGTGCAGGCTCTCGTGTGGAA
GTTCTGGCGCTGCAAGATTCCACGAATTCTCTCGAAAACGGGGCTGGGCAAATCCCACGGATGCTAAAGACACGG
CACTAATGTACGCCTATGGAACGAAACTAGATATTTTTGAGTGGCAGCAGTCCCTAGGCTATGGGACACATTTCA
TTGATCACATCAGCGGCTACGACCTTGGCCGCTTGCCGTGGATGGCTCCTGGCTTTTATCCAGTAAAAGAGAGGC
TGATTACCGGCGCCGATGCCGACCCAGAGGCTCCTTTTCTCGTTGATATTGCCGGCAACGTGGGGCATGACTTGG
CACGGTTCTACAAGTGCTATCCCAGCGTCCCGGGGAAATTAATTCTCGAGGATTTACCTAGCGTCATTAACACAA
TCCAGGACCTTGATCCAGCCATTATCCGTATAGGGTACGACTTTCATACCAAACAGCCTATTCAAGGTAAATGAT
TCTACCATTGTATTCTCACTCCACTTATCTAGAGAAAAGATGGACTAATATTATAAAGGAGCTCGAGCCTATTAT
ATGCGGAATATTTTGCACAACTGGCCGGATAAAGTATGCGATGATATTCTGGCCCAAGTCAAAACAGCAATGAAG
CCTGGATATAGCAGGCTACTCATCAACGAATACGTTATACCAGAGACTGGCGCCTACTGGGAAGCGACAGCACTT
GACATGGTCATGTTGACGCTCATGTCTGCTCACGAACGCACTCGCGCGGCTTGGTATAATCTTCTCGAGACGAGG
GCCGGTCTTTGTATCGTGAAGATTTGGAGCGGTGAGAAGAGCTCGCAGAGTTTAATCGAGTGTGAGCTCCGCGAG
GGTGGAAAATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail