Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|395
Gene name
LocationContig_109:27022..27385
Strand+
Gene length (bp)363
Transcript length (bp)363
Coding sequence length (bp)363
Protein length (aa) 121

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF17242 DUF5315 Disordered region of unknown function (DUF5315) 2.4E-15 1 48

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5317
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|395 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|8154
Ophiocordyceps camponoti-rufipedis Ophun1|592
Ophiocordyceps kimflemingae Ophio5|1865
Ophiocordyceps subramaniannii Hirsu2|4937

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|395
MQATLEEVELSASGGTHVFGPGHDGKLAELRKAQIELAHACAKYKVDDSTLPRGGNLATEDEAQEPDVLLAREKR
REANNEYFRCVNDGVVAVVAKLEDVAVAMREVEQESKEVWSEGTA*
Coding >OphauG2|395
ATGCAGGCTACGCTCGAGGAGGTTGAGCTTTCTGCCTCGGGTGGCACACATGTCTTTGGTCCAGGTCATGATGGC
AAATTGGCAGAGCTCCGAAAGGCGCAAATTGAGCTAGCTCATGCGTGCGCCAAGTATAAAGTGGATGATTCCACA
TTACCAAGAGGAGGAAACTTGGCTACAGAGGATGAGGCGCAGGAGCCTGACGTGTTACTTGCCCGCGAAAAAAGG
CGCGAGGCAAACAATGAATATTTTCGATGTGTCAACGACGGCGTCGTGGCCGTGGTGGCCAAGCTCGAAGATGTG
GCGGTGGCGATGCGAGAGGTGGAACAGGAGAGCAAGGAAGTATGGAGCGAAGGTACAGCTTGA
Transcript >OphauG2|395
ATGCAGGCTACGCTCGAGGAGGTTGAGCTTTCTGCCTCGGGTGGCACACATGTCTTTGGTCCAGGTCATGATGGC
AAATTGGCAGAGCTCCGAAAGGCGCAAATTGAGCTAGCTCATGCGTGCGCCAAGTATAAAGTGGATGATTCCACA
TTACCAAGAGGAGGAAACTTGGCTACAGAGGATGAGGCGCAGGAGCCTGACGTGTTACTTGCCCGCGAAAAAAGG
CGCGAGGCAAACAATGAATATTTTCGATGTGTCAACGACGGCGTCGTGGCCGTGGTGGCCAAGCTCGAAGATGTG
GCGGTGGCGATGCGAGAGGTGGAACAGGAGAGCAAGGAAGTATGGAGCGAAGGTACAGCTTGA
Gene >OphauG2|395
ATGCAGGCTACGCTCGAGGAGGTTGAGCTTTCTGCCTCGGGTGGCACACATGTCTTTGGTCCAGGTCATGATGGC
AAATTGGCAGAGCTCCGAAAGGCGCAAATTGAGCTAGCTCATGCGTGCGCCAAGTATAAAGTGGATGATTCCACA
TTACCAAGAGGAGGAAACTTGGCTACAGAGGATGAGGCGCAGGAGCCTGACGTGTTACTTGCCCGCGAAAAAAGG
CGCGAGGCAAACAATGAATATTTTCGATGTGTCAACGACGGCGTCGTGGCCGTGGTGGCCAAGCTCGAAGATGTG
GCGGTGGCGATGCGAGAGGTGGAACAGGAGAGCAAGGAAGTATGGAGCGAAGGTACAGCTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail