Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|3946
Gene name
LocationContig_311:3706..5353
Strand-
Gene length (bp)1647
Transcript length (bp)1455
Coding sequence length (bp)1455
Protein length (aa) 485

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08595 RXT2_N RXT2-like, N-terminal 1.1E-43 37 177

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O94355|RTX2_SCHPO Transcriptional regulatory protein rxt2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rtx2 PE=1 SV=2 8 182 3.0E-06

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup6295
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3946 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|489
Ophiocordyceps camponoti-floridani Ophcf2|01233
Ophiocordyceps kimflemingae Ophio5|3869
Ophiocordyceps subramaniannii Hirsu2|8772

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|3946
MASHQILFAETIAGMKKAFKRKAYDSDSDSAIENCGNRGYKLKKRALFARQGQLAPTQGPSSYRESVDYAGTQRA
IIHRNSPILDEDGYELDSEDDDERKEEAELAAAELNPYNSIRIEHILAPLTAATDLQAHTSLSKAFTSKTLTNLV
SHSCNMLRRENNTLWRIRHLLTMLCGDSTWIPCGRMVGPHDADLYREDHVAMHLLSLAQGSAAESSPPAIWSRET
RDESAKQASDTSTTAQVDDAEKRRQEKRDDGQGPAGHGDGSAEETHRIDAERAVATRSPGNNGVPCDPEDNLDNT
GPVQSTTGGNEGSRGNDGARNQGVDTQASGPESNPKIEVEAAAKLQGGTSEGAAPSTSPSAEQTVFIHPLFHMPP
GVQSDRDAGLPPNEAAEVRRLFLLYVQKQEEVSRGTDRLHQGLLKAERLKREVLHWSKAESHCGINRDMSDGEDW
YDKEEWGLEEDLKKGQDEEEEDTTTTGKKTRTRR*
Coding >OphauG2|3946
ATGGCGTCGCATCAGATTTTGTTCGCAGAGACGATAGCTGGCATGAAGAAGGCGTTCAAGCGAAAGGCCTATGAT
TCCGACTCGGACTCGGCCATCGAAAATTGCGGCAACCGTGGATACAAGCTCAAGAAGCGGGCGCTTTTTGCGCGT
CAGGGGCAATTGGCTCCCACGCAGGGGCCTAGTTCGTACAGAGAGTCTGTCGACTACGCCGGCACTCAAAGAGCC
ATCATACACCGAAATTCGCCGATCCTGGACGAGGACGGCTACGAATTGGATAGCGAAGACGATGACGAGCGCAAA
GAAGAGGCTGAACTTGCGGCAGCCGAGCTCAATCCCTACAACAGCATCCGCATAGAACATATTTTAGCACCCTTG
ACGGCTGCAACTGATCTTCAGGCACACACCTCGCTTTCGAAAGCCTTCACTTCCAAGACACTCACGAATCTCGTA
TCTCACAGCTGCAACATGTTGCGAAGAGAGAATAACACACTATGGCGGATTAGACACCTCTTGACAATGCTCTGT
GGCGACAGTACTTGGATACCATGCGGGCGCATGGTTGGTCCTCATGATGCCGATTTGTACCGCGAGGATCATGTT
GCTATGCATTTATTAAGTTTGGCTCAGGGCAGCGCTGCTGAGTCCTCGCCACCTGCCATTTGGAGCCGCGAGACG
AGAGACGAGAGTGCAAAGCAAGCTAGCGACACGAGCACTACTGCTCAGGTAGATGACGCGGAGAAAAGGCGGCAA
GAGAAGAGGGATGATGGCCAAGGTCCAGCTGGCCATGGTGACGGGTCAGCCGAGGAAACCCATCGCATTGACGCG
GAAAGAGCAGTCGCAACAAGATCACCTGGAAATAACGGCGTGCCATGCGACCCAGAGGATAATTTAGACAACACT
GGGCCTGTGCAAAGCACGACTGGCGGTAATGAAGGCAGCAGAGGTAATGATGGGGCTAGAAATCAAGGCGTTGAC
ACGCAGGCAAGCGGACCAGAGAGCAATCCCAAAATCGAAGTCGAAGCAGCGGCCAAACTGCAAGGCGGCACTTCA
GAGGGAGCAGCGCCGTCGACGAGTCCTAGTGCAGAACAGACGGTCTTTATTCATCCATTGTTTCATATGCCCCCT
GGAGTGCAATCGGACCGAGACGCGGGTTTGCCGCCAAATGAAGCGGCAGAAGTTAGAAGACTGTTTCTGCTCTAT
GTACAGAAGCAAGAAGAGGTCAGTCGCGGCACGGACCGACTGCACCAGGGCTTGCTCAAGGCTGAAAGGTTAAAG
AGAGAAGTACTACACTGGTCCAAGGCTGAGTCTCACTGTGGCATCAACCGCGACATGTCAGACGGCGAGGACTGG
TACGACAAGGAGGAATGGGGACTCGAAGAGGATCTGAAGAAGGGGCAAGACGAGGAAGAAGAAGACACGACGACA
ACAGGCAAGAAGACGCGCACGCGGCGGTAG
Transcript >OphauG2|3946
ATGGCGTCGCATCAGATTTTGTTCGCAGAGACGATAGCTGGCATGAAGAAGGCGTTCAAGCGAAAGGCCTATGAT
TCCGACTCGGACTCGGCCATCGAAAATTGCGGCAACCGTGGATACAAGCTCAAGAAGCGGGCGCTTTTTGCGCGT
CAGGGGCAATTGGCTCCCACGCAGGGGCCTAGTTCGTACAGAGAGTCTGTCGACTACGCCGGCACTCAAAGAGCC
ATCATACACCGAAATTCGCCGATCCTGGACGAGGACGGCTACGAATTGGATAGCGAAGACGATGACGAGCGCAAA
GAAGAGGCTGAACTTGCGGCAGCCGAGCTCAATCCCTACAACAGCATCCGCATAGAACATATTTTAGCACCCTTG
ACGGCTGCAACTGATCTTCAGGCACACACCTCGCTTTCGAAAGCCTTCACTTCCAAGACACTCACGAATCTCGTA
TCTCACAGCTGCAACATGTTGCGAAGAGAGAATAACACACTATGGCGGATTAGACACCTCTTGACAATGCTCTGT
GGCGACAGTACTTGGATACCATGCGGGCGCATGGTTGGTCCTCATGATGCCGATTTGTACCGCGAGGATCATGTT
GCTATGCATTTATTAAGTTTGGCTCAGGGCAGCGCTGCTGAGTCCTCGCCACCTGCCATTTGGAGCCGCGAGACG
AGAGACGAGAGTGCAAAGCAAGCTAGCGACACGAGCACTACTGCTCAGGTAGATGACGCGGAGAAAAGGCGGCAA
GAGAAGAGGGATGATGGCCAAGGTCCAGCTGGCCATGGTGACGGGTCAGCCGAGGAAACCCATCGCATTGACGCG
GAAAGAGCAGTCGCAACAAGATCACCTGGAAATAACGGCGTGCCATGCGACCCAGAGGATAATTTAGACAACACT
GGGCCTGTGCAAAGCACGACTGGCGGTAATGAAGGCAGCAGAGGTAATGATGGGGCTAGAAATCAAGGCGTTGAC
ACGCAGGCAAGCGGACCAGAGAGCAATCCCAAAATCGAAGTCGAAGCAGCGGCCAAACTGCAAGGCGGCACTTCA
GAGGGAGCAGCGCCGTCGACGAGTCCTAGTGCAGAACAGACGGTCTTTATTCATCCATTGTTTCATATGCCCCCT
GGAGTGCAATCGGACCGAGACGCGGGTTTGCCGCCAAATGAAGCGGCAGAAGTTAGAAGACTGTTTCTGCTCTAT
GTACAGAAGCAAGAAGAGGTCAGTCGCGGCACGGACCGACTGCACCAGGGCTTGCTCAAGGCTGAAAGGTTAAAG
AGAGAAGTACTACACTGGTCCAAGGCTGAGTCTCACTGTGGCATCAACCGCGACATGTCAGACGGCGAGGACTGG
TACGACAAGGAGGAATGGGGACTCGAAGAGGATCTGAAGAAGGGGCAAGACGAGGAAGAAGAAGACACGACGACA
ACAGGCAAGAAGACGCGCACGCGGCGGTAG
Gene >OphauG2|3946
ATGGCGTCGCATCAGATTTTGTTCGCAGAGACGATAGCTGGCATGAAGAAGGCGTTCAAGCGAAAGGCCTATGGT
GAGCATGTCCTAGTGACTAGACGATTTACTGTTTATATTGCTCACGTTGCCGCCGCTCTAGATTCCGACTCGGAC
TCGGCCATCGAAAATTGCGGCAACCGTGGATACAAGCTCAAGAAGCGGGCGCTTTTTGCGCGTCAGGGGCAATTG
GCTCCCACGCAGGGGCCTAGTTCGTACAGAGAGGCTTGTCTCGCGAGTCCGAGCCAGGGCTCATTGTTCTTGGCT
GACTCTATCTTTTTGTCCAGTCTGTCGACTACGCCGGCACTCAAAGAGCCATCATACACCGAAATTCGCCGATCC
TGGACGAGGACGGCTACGAATTGGATAGCGAAGACGATGACGAGCGCAAAGAAGAGGCTGAACTTGCGGCAGCCG
AGCTCAATCCCTACAACAGCATCCGCATAGAACGTACGCCACGCCACATTGGCTAGACCATGTTAGCCTTTTGTT
TGATGCCAAGCTAATCCCGTCTTAGATATTTTAGCACCCTTGACGGCTGCAACTGATCTTCAGGCACACACCTCG
CTTTCGAAAGCCTTCACTTCCAAGACACTCACGAATCTCGTATCTCACAGCTGCAACATGTTGCGAAGAGAGAAT
AACACACTATGGCGGATTAGACACCTCTTGACAATGCTCTGTGGCGACAGTACTTGGATACCATGCGGGCGCATG
GTTGGTCCTCATGATGCCGATTTGTACCGCGAGGATCATGTTGCTATGCATTTATTAAGTTTGGCTCAGGGCAGC
GCTGCTGAGTCCTCGCCACCTGCCATTTGGAGCCGCGAGACGAGAGACGAGAGTGCAAAGCAAGCTAGCGACACG
AGCACTACTGCTCAGGTAGATGACGCGGAGAAAAGGCGGCAAGAGAAGAGGGATGATGGCCAAGGTCCAGCTGGC
CATGGTGACGGGTCAGCCGAGGAAACCCATCGCATTGACGCGGAAAGAGCAGTCGCAACAAGATCACCTGGAAAT
AACGGCGTGCCATGCGACCCAGAGGATAATTTAGACAACACTGGGCCTGTGCAAAGCACGACTGGCGGTAATGAA
GGCAGCAGAGGTAATGATGGGGCTAGAAATCAAGGCGTTGACACGCAGGCAAGCGGACCAGAGAGCAATCCCAAA
ATCGAAGTCGAAGCAGCGGCCAAACTGCAAGGCGGCACTTCAGAGGGAGCAGCGCCGTCGACGAGTCCTAGTGCA
GAACAGACGGTCTTTATTCATCCATTGTTTCATATGCCCCCTGGAGTGCAATCGGACCGAGACGCGGGTTTGCCG
CCAAATGAAGCGGCAGAAGTTAGAAGACTGTTTCTGCTCTATGTACAGAAGCAAGAAGAGGTCAGTCGCGGCACG
GACCGACTGCACCAGGGCTTGCTCAAGGCTGAAAGGTTAAAGAGAGAAGTACTACACTGGTCCAAGGCTGAGTCT
CACTGTGGCATCAACCGCGACATGTCAGACGGCGAGGACTGGTACGACAAGGAGGAATGGGGACTCGAAGAGGAT
CTGAAGAAGGGGCAAGACGAGGAAGAAGAAGACACGACGACAACAGGCAAGAAGACGCGCACGCGGCGGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail