Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|3942
Gene name
LocationContig_310:11581..12583
Strand-
Gene length (bp)1002
Transcript length (bp)804
Coding sequence length (bp)804
Protein length (aa) 268

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00300 His_Phos_1 Histidine phosphatase superfamily (branch 1) 4.5E-28 3 164

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O94420|YQGD_SCHPO Probable phosphatase C1620.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1620.13 PE=3 SV=1 4 247 3.0E-21
sp|Q74L45|GPMA2_LACJO 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase 2 OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=gpmA2 PE=3 SV=1 2 191 3.0E-13
sp|B1WAX6|TIGAR_XENTR Fructose-2,6-bisphosphatase TIGAR OS=Xenopus tropicalis GN=tigar PE=2 SV=1 3 225 4.0E-13
sp|Q9SCS3|PGML4_ARATH Phosphoglycerate mutase-like protein 4 OS=Arabidopsis thaliana GN=At3g50520 PE=2 SV=1 3 170 7.0E-12
sp|Q4V7R0|TIGAR_XENLA Fructose-2,6-bisphosphatase TIGAR OS=Xenopus laevis GN=tigar PE=2 SV=1 3 131 7.0E-12
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O94420|YQGD_SCHPO Probable phosphatase C1620.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1620.13 PE=3 SV=1 4 247 3.0E-21
sp|Q74L45|GPMA2_LACJO 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase 2 OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=gpmA2 PE=3 SV=1 2 191 3.0E-13
sp|B1WAX6|TIGAR_XENTR Fructose-2,6-bisphosphatase TIGAR OS=Xenopus tropicalis GN=tigar PE=2 SV=1 3 225 4.0E-13
sp|Q9SCS3|PGML4_ARATH Phosphoglycerate mutase-like protein 4 OS=Arabidopsis thaliana GN=At3g50520 PE=2 SV=1 3 170 7.0E-12
sp|Q4V7R0|TIGAR_XENLA Fructose-2,6-bisphosphatase TIGAR OS=Xenopus laevis GN=tigar PE=2 SV=1 3 131 7.0E-12
sp|B4EY52|GPMB_PROMH Probable phosphoglycerate mutase GpmB OS=Proteus mirabilis (strain HI4320) GN=gpmB PE=3 SV=1 1 159 3.0E-11
sp|B1JL20|GPMB_YERPY Probable phosphoglycerate mutase GpmB OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=gpmB PE=3 SV=1 1 163 1.0E-10
sp|Q66EU3|GPMB_YERPS Probable phosphoglycerate mutase GpmB OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=gpmB PE=3 SV=1 1 163 1.0E-10
sp|A4TQH5|GPMB_YERPP Probable phosphoglycerate mutase GpmB OS=Yersinia pestis (strain Pestoides F) GN=gpmB PE=3 SV=1 1 163 1.0E-10
sp|Q1CMX2|GPMB_YERPN Probable phosphoglycerate mutase GpmB OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=gpmB PE=3 SV=1 1 163 1.0E-10
sp|A9R032|GPMB_YERPG Probable phosphoglycerate mutase GpmB OS=Yersinia pestis bv. Antiqua (strain Angola) GN=gpmB PE=3 SV=1 1 163 1.0E-10
sp|Q8ZIP0|GPMB_YERPE Probable phosphoglycerate mutase GpmB OS=Yersinia pestis GN=gpmB PE=3 SV=1 1 163 1.0E-10
sp|B2K3K5|GPMB_YERPB Probable phosphoglycerate mutase GpmB OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=gpmB PE=3 SV=1 1 163 1.0E-10
sp|Q1C0L5|GPMB_YERPA Probable phosphoglycerate mutase GpmB OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=gpmB PE=3 SV=1 1 163 1.0E-10
sp|A7FMF8|GPMB_YERP3 Probable phosphoglycerate mutase GpmB OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=gpmB PE=3 SV=1 1 163 1.0E-10
sp|Q7N900|GPMB_PHOLL Probable phosphoglycerate mutase GpmB OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=gpmB PE=3 SV=1 1 159 5.0E-10
sp|A8G9J4|GPMB_SERP5 Probable phosphoglycerate mutase GpmB OS=Serratia proteamaculans (strain 568) GN=gpmB PE=3 SV=1 1 159 7.0E-10
sp|A1JJB8|GPMB_YERE8 Probable phosphoglycerate mutase GpmB OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=gpmB PE=3 SV=1 1 163 1.0E-09
sp|A7MIJ0|GPMB_CROS8 Probable phosphoglycerate mutase GpmB OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=gpmB PE=3 SV=1 1 163 1.0E-09
sp|B5Y264|GPMB_KLEP3 Probable phosphoglycerate mutase GpmB OS=Klebsiella pneumoniae (strain 342) GN=gpmB PE=3 SV=1 1 163 1.0E-09
sp|A6TI09|GPMB_KLEP7 Probable phosphoglycerate mutase GpmB OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=gpmB PE=3 SV=1 1 163 2.0E-09
sp|B7LNT7|GPMB_ESCF3 Probable phosphoglycerate mutase GpmB OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=gpmB PE=3 SV=1 1 163 4.0E-09
sp|Q1JQA7|TIGAR_BOVIN Fructose-2,6-bisphosphatase TIGAR OS=Bos taurus GN=TIGAR PE=2 SV=1 3 144 5.0E-09
sp|O07617|PHOE_BACSU Uncharacterized phosphatase PhoE OS=Bacillus subtilis (strain 168) GN=phoE PE=3 SV=1 5 108 6.0E-09
sp|P39701|COBC_SALTY Adenosylcobalamin/alpha-ribazole phosphatase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=cobC PE=1 SV=3 1 159 6.0E-09
sp|Q8BZA9|TIGAR_MOUSE Fructose-2,6-bisphosphatase TIGAR OS=Mus musculus GN=Tigar PE=1 SV=1 3 131 9.0E-09
sp|Q7ZVE3|TIGRB_DANRE Fructose-2,6-bisphosphatase TIGAR B OS=Danio rerio GN=tigarb PE=1 SV=2 3 135 1.0E-08
sp|Q31SU3|GPMB_SHIBS Probable phosphoglycerate mutase GpmB OS=Shigella boydii serotype 4 (strain Sb227) GN=gpmB PE=3 SV=1 1 163 1.0E-08
sp|B2TZS8|GPMB_SHIB3 Probable phosphoglycerate mutase GpmB OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=gpmB PE=3 SV=1 1 163 1.0E-08
sp|Q3YTZ9|GPMB_SHISS Probable phosphoglycerate mutase GpmB OS=Shigella sonnei (strain Ss046) GN=gpmB PE=3 SV=1 1 163 1.0E-08
sp|P0A7A4|GPMB_SHIFL Probable phosphoglycerate mutase GpmB OS=Shigella flexneri GN=gpmB PE=3 SV=1 1 163 1.0E-08
sp|Q0SX17|GPMB_SHIF8 Probable phosphoglycerate mutase GpmB OS=Shigella flexneri serotype 5b (strain 8401) GN=gpmB PE=3 SV=1 1 163 1.0E-08
sp|B1LEK2|GPMB_ECOSM Probable phosphoglycerate mutase GpmB OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=gpmB PE=3 SV=1 1 163 1.0E-08
sp|B6I6P3|GPMB_ECOSE Probable phosphoglycerate mutase GpmB OS=Escherichia coli (strain SE11) GN=gpmB PE=3 SV=1 1 163 1.0E-08
sp|B7NH70|GPMB_ECOLU Probable phosphoglycerate mutase GpmB OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=gpmB PE=3 SV=1 1 163 1.0E-08
sp|P0A7A2|GPMB_ECOLI Probable phosphoglycerate mutase GpmB OS=Escherichia coli (strain K12) GN=gpmB PE=3 SV=1 1 163 1.0E-08
sp|B1IS24|GPMB_ECOLC Probable phosphoglycerate mutase GpmB OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=gpmB PE=3 SV=1 1 163 1.0E-08
sp|A8A8C4|GPMB_ECOHS Probable phosphoglycerate mutase GpmB OS=Escherichia coli O9:H4 (strain HS) GN=gpmB PE=3 SV=1 1 163 1.0E-08
sp|B1XFK5|GPMB_ECODH Probable phosphoglycerate mutase GpmB OS=Escherichia coli (strain K12 / DH10B) GN=gpmB PE=3 SV=1 1 163 1.0E-08
sp|C4ZT77|GPMB_ECOBW Probable phosphoglycerate mutase GpmB OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=gpmB PE=3 SV=1 1 163 1.0E-08
sp|B7LXV9|GPMB_ECO8A Probable phosphoglycerate mutase GpmB OS=Escherichia coli O8 (strain IAI1) GN=gpmB PE=3 SV=1 1 163 1.0E-08
sp|B5Z4S7|GPMB_ECO5E Probable phosphoglycerate mutase GpmB OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=gpmB PE=3 SV=1 1 163 1.0E-08
sp|P0A7A3|GPMB_ECO57 Probable phosphoglycerate mutase GpmB OS=Escherichia coli O157:H7 GN=gpmB PE=3 SV=1 1 163 1.0E-08
sp|B7LEP1|GPMB_ECO55 Probable phosphoglycerate mutase GpmB OS=Escherichia coli (strain 55989 / EAEC) GN=gpmB PE=3 SV=1 1 163 1.0E-08
sp|A7ZVT7|GPMB_ECO24 Probable phosphoglycerate mutase GpmB OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=gpmB PE=3 SV=1 1 163 1.0E-08
sp|C3MBY8|GPMA_RHISN 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Rhizobium sp. (strain NGR234) GN=gpmA PE=3 SV=1 3 187 4.0E-08
sp|B5BAL1|GPMB_SALPK Probable phosphoglycerate mutase GpmB OS=Salmonella paratyphi A (strain AKU_12601) GN=gpmB PE=3 SV=1 1 163 4.0E-08
sp|Q8L1Z7|GPMA_BARHE 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=gpmA PE=3 SV=1 3 189 4.0E-08
sp|A1UTM4|GPMA_BARBK 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=gpmA PE=3 SV=1 3 168 4.0E-08
sp|B2VH13|GPMB_ERWT9 Probable phosphoglycerate mutase GpmB OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=gpmB PE=3 SV=1 1 163 6.0E-08
sp|Q57G26|GPMB_SALCH Probable phosphoglycerate mutase GpmB OS=Salmonella choleraesuis (strain SC-B67) GN=gpmB PE=3 SV=1 1 163 7.0E-08
sp|Q92T25|GPMA_RHIME 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Rhizobium meliloti (strain 1021) GN=gpmA PE=3 SV=1 3 187 7.0E-08
sp|B9JYQ2|GPMA_AGRVS 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=gpmA PE=3 SV=1 3 187 9.0E-08
sp|Q8ZJU8|GPMB_SALTY Probable phosphoglycerate mutase GpmB OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=gpmB PE=3 SV=1 1 163 1.0E-07
sp|B4TU55|GPMB_SALSV Probable phosphoglycerate mutase GpmB OS=Salmonella schwarzengrund (strain CVM19633) GN=gpmB PE=3 SV=1 1 163 1.0E-07
sp|A9N7F5|GPMB_SALPB Probable phosphoglycerate mutase GpmB OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=gpmB PE=3 SV=1 1 163 1.0E-07
sp|Q5PK44|GPMB_SALPA Probable phosphoglycerate mutase GpmB OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=gpmB PE=3 SV=1 1 163 1.0E-07
sp|B4T4I9|GPMB_SALNS Probable phosphoglycerate mutase GpmB OS=Salmonella newport (strain SL254) GN=gpmB PE=3 SV=1 1 163 1.0E-07
sp|B4TH18|GPMB_SALHS Probable phosphoglycerate mutase GpmB OS=Salmonella heidelberg (strain SL476) GN=gpmB PE=3 SV=1 1 163 1.0E-07
sp|B5R9W3|GPMB_SALG2 Probable phosphoglycerate mutase GpmB OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=gpmB PE=3 SV=1 1 163 1.0E-07
sp|B5R3B7|GPMB_SALEP Probable phosphoglycerate mutase GpmB OS=Salmonella enteritidis PT4 (strain P125109) GN=gpmB PE=3 SV=1 1 163 1.0E-07
sp|B5FTD9|GPMB_SALDC Probable phosphoglycerate mutase GpmB OS=Salmonella dublin (strain CT_02021853) GN=gpmB PE=3 SV=1 1 163 1.0E-07
sp|B5F543|GPMB_SALA4 Probable phosphoglycerate mutase GpmB OS=Salmonella agona (strain SL483) GN=gpmB PE=3 SV=1 1 163 1.0E-07
sp|A9MR94|GPMB_SALAR Probable phosphoglycerate mutase GpmB OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=gpmB PE=3 SV=1 1 163 1.0E-07
sp|F4KI56|SERCL_ARATH Metal-independent phosphoserine phosphatase OS=Arabidopsis thaliana GN=IPSP PE=1 SV=1 3 160 1.0E-07
sp|P58652|COBC_SALTI Adenosylcobalamin/alpha-ribazole phosphatase OS=Salmonella typhi GN=cobC PE=3 SV=1 1 128 1.0E-07
sp|Q327K0|GPMB_SHIDS Probable phosphoglycerate mutase GpmB OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=gpmB PE=3 SV=1 1 163 1.0E-07
sp|Q8KL44|GPMA_RHIEC 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=gpmA PE=3 SV=1 3 187 2.0E-07
sp|Q1R246|GPMB_ECOUT Probable phosphoglycerate mutase GpmB OS=Escherichia coli (strain UTI89 / UPEC) GN=gpmB PE=3 SV=1 1 163 2.0E-07
sp|Q8FA40|GPMB_ECOL6 Probable phosphoglycerate mutase GpmB OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=gpmB PE=3 SV=1 1 163 2.0E-07
sp|Q0T8R6|GPMB_ECOL5 Probable phosphoglycerate mutase GpmB OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=gpmB PE=3 SV=1 1 163 2.0E-07
sp|A1AJW4|GPMB_ECOK1 Probable phosphoglycerate mutase GpmB OS=Escherichia coli O1:K1 / APEC GN=gpmB PE=3 SV=1 1 163 2.0E-07
sp|B7MTE3|GPMB_ECO81 Probable phosphoglycerate mutase GpmB OS=Escherichia coli O81 (strain ED1a) GN=gpmB PE=3 SV=1 1 163 2.0E-07
sp|B7NW76|GPMB_ECO7I Probable phosphoglycerate mutase GpmB OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=gpmB PE=3 SV=1 1 163 2.0E-07
sp|B7MNK4|GPMB_ECO45 Probable phosphoglycerate mutase GpmB OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=gpmB PE=3 SV=1 1 163 2.0E-07
sp|Q9HIJ2|GPM_THEAC 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=Ta1347 PE=1 SV=2 4 108 2.0E-07
sp|A6UEW3|GPMA_SINMW 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Sinorhizobium medicae (strain WSM419) GN=gpmA PE=3 SV=1 3 187 2.0E-07
sp|P52086|COBC_ECOLI Adenosylcobalamin/alpha-ribazole phosphatase OS=Escherichia coli (strain K12) GN=cobC PE=3 SV=1 1 159 2.0E-07
sp|A8ALW1|GPMB_CITK8 Probable phosphoglycerate mutase GpmB OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=gpmB PE=3 SV=1 1 163 2.0E-07
sp|A4W6B3|GPMB_ENT38 Probable phosphoglycerate mutase GpmB OS=Enterobacter sp. (strain 638) GN=gpmB PE=3 SV=1 1 163 2.0E-07
sp|O94461|YFFL_SCHPO Probable phosphatase C1687.21 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1687.21 PE=3 SV=1 1 159 2.0E-07
sp|Q8Z0T4|GPMB_SALTI Probable phosphoglycerate mutase GpmB OS=Salmonella typhi GN=gpmB PE=3 SV=1 1 163 2.0E-07
sp|Q9NQ88|TIGAR_HUMAN Fructose-2,6-bisphosphatase TIGAR OS=Homo sapiens GN=TIGAR PE=1 SV=1 3 131 4.0E-07
sp|C0Q8F5|GPMB_SALPC Probable phosphoglycerate mutase GpmB OS=Salmonella paratyphi C (strain RKS4594) GN=gpmB PE=3 SV=1 1 163 5.0E-07
sp|Q7NJF7|GPMA2_GLOVI 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase 2 OS=Gloeobacter violaceus (strain PCC 7421) GN=gpmA2 PE=3 SV=1 3 153 7.0E-07
sp|Q12040|YO283_YEAST Broad-specificity phosphatase YOR283W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOR283W PE=1 SV=1 1 164 1.0E-06
sp|Q6FZ12|GPMA_BARQU 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Bartonella quintana (strain Toulouse) GN=gpmA PE=3 SV=1 3 133 1.0E-06
sp|Q11SV1|GPMA_CYTH3 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=gpmA PE=3 SV=1 3 153 1.0E-06
sp|Q38ZH8|GPMA1_LACSS 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase 1 OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=gpmA1 PE=3 SV=1 3 93 2.0E-06
sp|A4T096|GPMA_POLSQ 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=gpmA PE=3 SV=1 2 93 3.0E-06
sp|B1XS92|GPMA_POLNS 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Polynucleobacter necessarius subsp. necessarius (strain STIR1) GN=gpmA PE=3 SV=1 2 93 3.0E-06
sp|Q5YP50|GPMA_NOCFA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Nocardia farcinica (strain IFM 10152) GN=gpmA PE=3 SV=1 3 95 4.0E-06
sp|Q2YBZ1|GPMA1_NITMU 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase 1 OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=gpmA1 PE=3 SV=1 2 93 5.0E-06
sp|A5VVV5|GPMA_BRUO2 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=gpmA PE=3 SV=1 3 182 6.0E-06
sp|P59160|GPMA_BRUSU 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Brucella suis biovar 1 (strain 1330) GN=gpmA PE=3 SV=1 3 182 7.0E-06
sp|A9WW62|GPMA_BRUSI 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=gpmA PE=3 SV=1 3 182 7.0E-06
sp|A9MCX8|GPMA_BRUC2 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=gpmA PE=3 SV=1 3 182 7.0E-06
sp|Q576R3|GPMA_BRUAB 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Brucella abortus biovar 1 (strain 9-941) GN=gpmA PE=3 SV=1 3 182 7.0E-06
sp|Q2YJN6|GPMA_BRUA2 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Brucella abortus (strain 2308) GN=gpmA PE=3 SV=1 3 182 7.0E-06
sp|B2SC37|GPMA_BRUA1 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Brucella abortus (strain S19) GN=gpmA PE=3 SV=1 3 182 7.0E-06
sp|Q8YDC9|GPMA_BRUME 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=gpmA PE=3 SV=2 3 182 8.0E-06
sp|C0RMJ1|GPMA_BRUMB 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=gpmA PE=3 SV=1 3 182 8.0E-06
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup6488
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3942 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|3135
Ophiocordyceps subramaniannii Hirsu2|10318

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|3942
MRLLIIRHGESVDNVARLYAGSRDSPLTTHGALQADRLASSFSKFVELTHIYSSPLQRAAQTAQIICDAQHPESL
VVIHIDELREKHFGSGEGQSYHAKGSVLQNGLYLPQGAESNESMNARMHSFFNCHLEPLLHLECESGQDMACAIV
SHGIILSVLYKVLSSKASRITTPESLSAKSANASPVCPTWSNTGFLDITLSRTNHSLPLVLCIRGVNCTSHLANL
RKTQGGIGSAPLDRRQRTIRQFFMPKSSQDATNGKHGTSNRV*
Coding >OphauG2|3942
ATGCGCCTCTTGATAATCCGTCACGGTGAAAGTGTTGACAACGTTGCCCGTCTCTACGCCGGATCGCGTGACAGC
CCTCTCACGACCCACGGCGCCCTACAAGCAGACCGCCTAGCTTCTAGCTTTTCCAAGTTTGTGGAGCTGACACAC
ATATATTCGTCGCCACTTCAGCGCGCTGCCCAGACGGCACAGATAATATGTGACGCTCAGCATCCAGAATCTCTC
GTCGTTATTCATATTGATGAGCTGCGGGAGAAGCATTTTGGAAGCGGAGAGGGTCAAAGTTATCACGCCAAAGGC
TCAGTCTTGCAAAACGGGCTATACTTGCCCCAGGGTGCCGAGTCGAATGAATCAATGAACGCAAGGATGCATTCT
TTCTTCAATTGCCATTTAGAACCACTGCTGCATCTCGAGTGCGAATCTGGCCAGGACATGGCGTGTGCCATTGTA
TCTCATGGCATAATACTATCAGTTCTCTACAAAGTTCTCTCCAGCAAGGCTTCACGCATTACTACTCCTGAGTCT
CTGTCAGCCAAATCTGCCAATGCGTCACCTGTCTGCCCTACATGGAGCAACACTGGCTTTCTCGATATCACTCTC
TCCAGAACCAACCACTCGTTGCCACTCGTTTTGTGTATACGGGGCGTGAATTGCACATCACATCTCGCCAATCTC
CGCAAGACACAGGGTGGTATTGGCAGCGCCCCTCTGGATCGGCGACAGCGGACAATACGCCAGTTTTTTATGCCT
AAATCGAGCCAAGACGCCACAAATGGAAAACATGGAACTAGCAACCGTGTTTGA
Transcript >OphauG2|3942
ATGCGCCTCTTGATAATCCGTCACGGTGAAAGTGTTGACAACGTTGCCCGTCTCTACGCCGGATCGCGTGACAGC
CCTCTCACGACCCACGGCGCCCTACAAGCAGACCGCCTAGCTTCTAGCTTTTCCAAGTTTGTGGAGCTGACACAC
ATATATTCGTCGCCACTTCAGCGCGCTGCCCAGACGGCACAGATAATATGTGACGCTCAGCATCCAGAATCTCTC
GTCGTTATTCATATTGATGAGCTGCGGGAGAAGCATTTTGGAAGCGGAGAGGGTCAAAGTTATCACGCCAAAGGC
TCAGTCTTGCAAAACGGGCTATACTTGCCCCAGGGTGCCGAGTCGAATGAATCAATGAACGCAAGGATGCATTCT
TTCTTCAATTGCCATTTAGAACCACTGCTGCATCTCGAGTGCGAATCTGGCCAGGACATGGCGTGTGCCATTGTA
TCTCATGGCATAATACTATCAGTTCTCTACAAAGTTCTCTCCAGCAAGGCTTCACGCATTACTACTCCTGAGTCT
CTGTCAGCCAAATCTGCCAATGCGTCACCTGTCTGCCCTACATGGAGCAACACTGGCTTTCTCGATATCACTCTC
TCCAGAACCAACCACTCGTTGCCACTCGTTTTGTGTATACGGGGCGTGAATTGCACATCACATCTCGCCAATCTC
CGCAAGACACAGGGTGGTATTGGCAGCGCCCCTCTGGATCGGCGACAGCGGACAATACGCCAGTTTTTTATGCCT
AAATCGAGCCAAGACGCCACAAATGGAAAACATGGAACTAGCAACCGTGTTTGA
Gene >OphauG2|3942
ATGCGCCTCTTGATAATCCGTCACGGTGAAAGTGTTGACAACGTTGCCCGTCTCTACGCCGGATCGCGTGACAGC
CCTCTCACGACCCACGGCGCCCTACAAGCAGACCGCCTAGCTTCTAGCTTTTCCAAGTTTGTGGAGCTGACACAC
ATATATTCGTCGCCACTTCAGCGCGCTGCCCAGACGGCACAGATAATATGTGACGCTCAGCATCCAGAATCTCTC
GTCGTTATTCATATTGATGAGCTGCGGGAGAAGCATTTTGGAAGCGGAGAGGGTCAAAGTTATCACGCCAAAGGC
TCAGTCTTGCAAAACGGGCTATACTTGCCCCAGGGTGCCGAGTCGAATGAATCAATGAACGCAAGGATGCATTCT
TTCTTCAATTGCCATTTAGAACCACTGCTGCATCTCGAGTGCGAATCTGGCCAGGACATGGCGTGTGCCATTGTA
TCTCATGGCATAATACTATCAGTTCTCTACAAAGTTCTCTCCAGCAAGGCTTCACGCATTACTACTCCTGAGTCT
CTGTCAGCCAAATCTGCCAATGCGTCACCTGTCTGCCCTACATGGAGCAACACTGGCTTTCTCGATATCACTCTC
TCCAGAACCAACCACTCGTTGCCACTCGTTTTGTGTATACGGGGCGTGAATTGCACATCACATCTCGCCAATCTC
CGCAAGACACAGGGTGGTATTGGCAGCGCCCCTCTGGATCGGCGACAGCGGACAATACGCCAGTTTTTTATGCCT
AAATCGAGCCAAGACGCCACAAATGGAAAACGTGAGTTGGCTTCTCGTGTTTTTGTTCATTATATCTGTCCGGTG
TCATGATGAAACAAGGAGAATTCACAGACCTGTACCGAACTTGAATGTGGAAAAAACTTGTCCAACCGCTGTCTG
ATATTACCGTCCTTTTAACTAGTCTCTTGTCTGCACTGCGCTATGCAAGTTTGCATAATCACTAACGGCACACCT
ACAGATGGAACTAGCAACCGTGTTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail