Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|3925
Gene name
LocationContig_309:12608..17160
Strand+
Gene length (bp)4552
Transcript length (bp)4329
Coding sequence length (bp)4329
Protein length (aa) 1443

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03178 CPSF_A CPSF A subunit region 6.7E-74 1055 1404
PF10433 MMS1_N Mono-functional DNA-alkylating methyl methanesulfonate N-term 1.3E-14 174 748

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q0UUE2|CFT1_PHANO Protein CFT1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=CFT1 PE=3 SV=1 1 1420 0.0E+00
sp|Q1E5B0|CFT1_COCIM Protein CFT1 OS=Coccidioides immitis (strain RS) GN=CFT1 PE=3 SV=1 1 1435 0.0E+00
sp|A1DB13|CFT1_NEOFI Protein cft1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=cft1 PE=3 SV=1 1 1442 0.0E+00
sp|Q4WCL1|CFT1_ASPFU Protein cft1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=cft1 PE=3 SV=2 1 1442 0.0E+00
sp|A1C3U1|CFT1_ASPCL Protein cft1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=cft1 PE=3 SV=1 1 1435 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q0UUE2|CFT1_PHANO Protein CFT1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=CFT1 PE=3 SV=1 1 1420 0.0E+00
sp|Q1E5B0|CFT1_COCIM Protein CFT1 OS=Coccidioides immitis (strain RS) GN=CFT1 PE=3 SV=1 1 1435 0.0E+00
sp|A1DB13|CFT1_NEOFI Protein cft1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=cft1 PE=3 SV=1 1 1442 0.0E+00
sp|Q4WCL1|CFT1_ASPFU Protein cft1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=cft1 PE=3 SV=2 1 1442 0.0E+00
sp|A1C3U1|CFT1_ASPCL Protein cft1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=cft1 PE=3 SV=1 1 1435 0.0E+00
sp|Q2TZ19|CFT1_ASPOR Protein cft1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=cft1 PE=3 SV=1 1 1435 0.0E+00
sp|Q5BDG7|CFT1_EMENI Protein cft1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cft1 PE=3 SV=1 1 1435 0.0E+00
sp|A2R919|CFT1_ASPNC Protein cft1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=cft1 PE=3 SV=1 1 1435 0.0E+00
sp|Q7SEY2|CFT1_NEUCR Protein cft1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=paa-3 PE=3 SV=3 1 1420 0.0E+00
sp|Q6BHK3|CFT1_DEBHA Protein CFT1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=CFT1 PE=3 SV=2 1 1430 4.0E-116
sp|Q6C740|CFT1_YARLI Protein CFT1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=CFT1 PE=3 SV=1 1 1419 3.0E-109
sp|Q10569|CPSF1_BOVIN Cleavage and polyadenylation specificity factor subunit 1 OS=Bos taurus GN=CPSF1 PE=1 SV=1 3 1419 5.0E-109
sp|Q6CTT2|CFT1_KLULA Protein CFT1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=CFT1 PE=3 SV=1 1 1430 5.0E-87
sp|Q6FSD2|CFT1_CANGA Protein CFT1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=CFT1 PE=3 SV=1 85 1430 3.0E-83
sp|Q75EY8|CFT1_ASHGO Protein CFT1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=CFT1 PE=3 SV=1 72 1430 5.0E-78
sp|Q06632|CFT1_YEAST Protein CFT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CFT1 PE=1 SV=1 85 1419 2.0E-75
sp|O74733|CFT1_SCHPO Protein cft1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cft1 PE=3 SV=1 787 1419 3.0E-74
sp|O74733|CFT1_SCHPO Protein cft1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cft1 PE=3 SV=1 3 738 1.0E-65
sp|Q5AFT3|CFT1_CANAL Protein CFT1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CFT1 PE=3 SV=1 837 1423 5.0E-64
sp|Q9EPU4|CPSF1_MOUSE Cleavage and polyadenylation specificity factor subunit 1 OS=Mus musculus GN=Cpsf1 PE=1 SV=1 789 1419 4.0E-55
sp|Q10570|CPSF1_HUMAN Cleavage and polyadenylation specificity factor subunit 1 OS=Homo sapiens GN=CPSF1 PE=1 SV=2 789 1419 6.0E-54
sp|Q9EPU4|CPSF1_MOUSE Cleavage and polyadenylation specificity factor subunit 1 OS=Mus musculus GN=Cpsf1 PE=1 SV=1 3 771 2.0E-47
sp|Q10570|CPSF1_HUMAN Cleavage and polyadenylation specificity factor subunit 1 OS=Homo sapiens GN=CPSF1 PE=1 SV=2 88 766 8.0E-47
sp|Q9V726|CPSF1_DROME Cleavage and polyadenylation specificity factor subunit 1 OS=Drosophila melanogaster GN=Cpsf160 PE=1 SV=1 794 1428 8.0E-45
sp|Q9V726|CPSF1_DROME Cleavage and polyadenylation specificity factor subunit 1 OS=Drosophila melanogaster GN=Cpsf160 PE=1 SV=1 98 732 3.0E-43
sp|Q5AFT3|CFT1_CANAL Protein CFT1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CFT1 PE=3 SV=1 1 770 6.0E-43
sp|Q7XWP1|CPSF1_ORYSJ Probable cleavage and polyadenylation specificity factor subunit 1 OS=Oryza sativa subsp. japonica GN=Os04g0252200 PE=3 SV=2 920 1419 1.0E-42
sp|P0CM62|CFT1_CRYNJ Protein CFT1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CFT1 PE=3 SV=1 28 732 1.0E-40
sp|P0CM63|CFT1_CRYNB Protein CFT1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=CFT1 PE=3 SV=1 28 732 1.0E-40
sp|P0CM62|CFT1_CRYNJ Protein CFT1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CFT1 PE=3 SV=1 790 1436 4.0E-38
sp|P0CM63|CFT1_CRYNB Protein CFT1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=CFT1 PE=3 SV=1 790 1436 4.0E-38
sp|Q9FGR0|CPSF1_ARATH Cleavage and polyadenylation specificity factor subunit 1 OS=Arabidopsis thaliana GN=CPSF160 PE=1 SV=2 920 1419 2.0E-32
sp|A8XPU7|CPSF1_CAEBR Probable cleavage and polyadenylation specificity factor subunit 1 OS=Caenorhabditis briggsae GN=cpsf-1 PE=3 SV=1 955 1428 8.0E-32
sp|Q9N4C2|CPSF1_CAEEL Probable cleavage and polyadenylation specificity factor subunit 1 OS=Caenorhabditis elegans GN=cpsf-1 PE=3 SV=2 955 1428 4.0E-31
sp|Q7XWP1|CPSF1_ORYSJ Probable cleavage and polyadenylation specificity factor subunit 1 OS=Oryza sativa subsp. japonica GN=Os04g0252200 PE=3 SV=2 28 732 8.0E-28
sp|Q9FGR0|CPSF1_ARATH Cleavage and polyadenylation specificity factor subunit 1 OS=Arabidopsis thaliana GN=CPSF160 PE=1 SV=2 99 732 1.0E-27
sp|Q9N4C2|CPSF1_CAEEL Probable cleavage and polyadenylation specificity factor subunit 1 OS=Caenorhabditis elegans GN=cpsf-1 PE=3 SV=2 127 767 4.0E-23
sp|A8XPU7|CPSF1_CAEBR Probable cleavage and polyadenylation specificity factor subunit 1 OS=Caenorhabditis briggsae GN=cpsf-1 PE=3 SV=1 127 777 6.0E-23
[Show less]

GO

GO Term Description Terminal node
GO:0005634 nucleus Yes
GO:0003676 nucleic acid binding Yes
GO:0003674 molecular_function No
GO:0043229 intracellular organelle No
GO:0043231 intracellular membrane-bounded organelle No
GO:1901363 heterocyclic compound binding No
GO:0043227 membrane-bounded organelle No
GO:0043226 organelle No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No
GO:0005575 cellular_component No
GO:0110165 cellular anatomical entity No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2315
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3925 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|6305
Ophiocordyceps camponoti-floridani Ophcf2|02452
Ophiocordyceps camponoti-rufipedis Ophun1|6059
Ophiocordyceps kimflemingae Ophio5|5635
Ophiocordyceps subramaniannii Hirsu2|3107

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|3925
MQVYTELVAPSAVTHCLSLSLTSSSATNLVVAKGSLLQIFTVKSISAELDPQTHQADEDTSKPDAHFDHRANDDD
GLESSFLGGEVMLLRTDRSTNAKLVLVAELTLAGTVIGLARVRIAKTASGGEGLLIAYRAAKMSLNEWHPQRATL
ETTSIHFYEKDELMGVPWELPLSDYVNYLEADPGSRCAALKFGSRNLAILPFAQSEQDLGMDDWDEDLDGPRPPK
EAATLAEGADGKLAPAYTPSFVLSLPLLDPTLLHPIHLAFLHEYREPTFGILSAVQAPSSALGLKDSLSYKVFTL
DLKQRASTTILSVTGLPQDLFRVVALPAPMGGALLVGLNELIHIDQSGKPNGVAVNDVAKQATSFSLSDQSDLNW
RLERCAIELLAIDNGELLLVLNDGRLGIVNFKIDGRTVSGISVKPVAPDCGGQLISSSVSCMSRLDSKSIFVGSG
SGDSVVLGWSRKQSQEKRQKTRFLDPDLGIDIEDLELSEDDDDDLYGNDNVATKTSQAANGTTKLGEVIFKIQDT
LLCIAPLLDMTCGSPAPLPGAERAQLDQGVSAQLQLACAVGRDKAGSIAILNRNIQPKIIGRFEFPEARGFWTMC
VKKPMPKSLGATAAVGSDYDTTAQYDRYMIVAKVDLDGYETSDVYALRAAGFESLKETEFEPAAGFTVEAGVMGK
QMRIIQVLKSEVRCYDGDLGLAQIVPMLDEETGAEPRVTSASIVDPYLLLIRDDGTVFVAQIDGNNELDEMDKAD
SPLQTTKWTAGCLYSDALCTFRPDVGDKGVEIGDKVLMFLLNSAGALHIYELPDVAKPVFVAECLTSIPPILSAD
YAARRGASRETVSEILVADLGDTVSQAPYLIVRHCTDDLTLYEPIRYAGNGSSTGLEATLAFKKCANGVLAQYAD
ASPRDESEPPRFVPLRRCANIGGFSTVFLPGPCPSFVLKSSKSIPRIVGLEGLGVRGMSTFHAEGCDRGFIYADS
EGVARVTQLPAATNLAEFGLSVKKIALGGDVDKISYHHPTGTYIAACTVMEPFELPRDDDYHREWARESCRLAPA
MPRGMLKLINPATWTVIHTVEMESSESIESMRTLLLEVSEETRERRMLLAVGTALSKGEDLPTRGRVQVFDIVTV
IPESNRPETNRRLKLIAKEDIPRGGVTALSEIGRQGLMLVAQGQKCMVRGLKEDGSLLPVAFLDMNCHVASIREL
PGTGLCLLADAFKGLWFTGYTEEPYTFKVLGKSSGRLPLLVADFLPDGDDLSMVAVDADGDLHIFEFDPEHSKSL
QGHILLHRATFSVAPNIATTTLLLPRTLPPSHANPQQQQGAAPTQQAHILLVASPSGHLAALTPVPESTYRRLLS
VANQLVPALPAHGGLHAKTFRLPDSQQAGRAALPVGVDTGGRAVVDGAVLAAWTALGAAKRAEVAGKGGYDGVGD
LREDLQALLGWHSLSYF*
Coding >OphauG2|3925
ATGCAAGTCTACACGGAGCTCGTGGCTCCCTCGGCCGTCACCCATTGTCTAAGCCTGTCTCTCACATCGTCGTCG
GCCACCAATCTTGTCGTCGCAAAAGGCTCGCTGCTGCAAATCTTCACCGTCAAATCCATCTCGGCCGAGCTCGAT
CCCCAGACCCACCAGGCCGACGAGGACACATCTAAACCCGACGCACACTTCGACCACCGTGCCAATGATGATGAT
GGCCTCGAGTCATCCTTTCTTGGAGGCGAGGTCATGCTGTTGCGTACCGACCGCTCAACCAATGCCAAGCTGGTC
CTCGTGGCCGAGCTTACTCTTGCTGGCACCGTCATCGGCCTGGCTCGTGTCAGGATCGCAAAGACAGCTTCAGGA
GGCGAGGGGCTGCTTATCGCCTACCGTGCCGCCAAGATGAGCCTCAACGAGTGGCATCCGCAGAGGGCCACGCTC
GAAACGACGTCGATCCACTTCTACGAAAAAGACGAGCTCATGGGTGTGCCTTGGGAGCTGCCCCTGAGCGACTAC
GTCAACTACCTAGAGGCTGATCCAGGGAGCCGATGCGCCGCTCTCAAATTCGGTTCCCGTAACCTGGCAATTCTG
CCTTTTGCTCAGTCGGAGCAGGATCTCGGCATGGACGACTGGGATGAGGATCTCGACGGACCACGTCCGCCCAAG
GAGGCCGCCACGCTGGCTGAGGGAGCTGATGGCAAGCTTGCACCTGCATATACGCCTTCATTTGTTTTGAGCCTT
CCTCTGCTCGACCCTACACTGCTCCATCCAATCCACCTTGCCTTTCTACACGAGTACCGCGAGCCGACATTTGGC
ATTCTTTCCGCAGTCCAGGCTCCTTCATCTGCCCTCGGACTCAAGGACAGTCTGTCCTACAAGGTGTTCACTCTG
GATCTTAAGCAGCGAGCTTCAACGACTATTTTATCTGTGACGGGCTTGCCTCAGGACCTCTTTCGAGTTGTTGCC
CTACCAGCGCCAATGGGCGGCGCTCTTCTTGTCGGTCTCAACGAGCTCATTCATATAGATCAATCTGGGAAGCCC
AACGGAGTGGCAGTCAATGATGTTGCAAAGCAAGCCACTTCTTTTAGCCTATCTGATCAGTCAGATCTCAACTGG
AGACTGGAACGCTGTGCCATTGAGCTCCTTGCCATTGATAACGGCGAGCTCCTGTTGGTTCTAAATGATGGCCGC
CTCGGCATCGTCAACTTCAAGATAGACGGACGCACTGTATCAGGAATTAGTGTCAAACCAGTGGCCCCAGACTGC
GGGGGACAATTGATCAGCAGCAGCGTCTCATGCATGTCGCGCCTTGATAGCAAATCTATTTTCGTCGGAAGCGGA
AGCGGAGATAGTGTCGTTCTGGGCTGGTCCAGGAAACAGAGCCAGGAAAAACGACAAAAGACACGTTTTCTAGAC
CCCGACTTGGGAATCGACATTGAGGACCTGGAATTGAGTGAGGATGATGATGACGACTTGTACGGCAACGATAAT
GTAGCAACTAAGACGTCTCAGGCCGCCAATGGCACAACAAAGCTTGGAGAGGTGATTTTCAAAATACAAGACACG
CTGCTTTGCATCGCACCGCTACTCGACATGACATGTGGAAGTCCAGCCCCGCTACCCGGCGCCGAAAGGGCTCAG
TTGGATCAGGGCGTATCAGCTCAGCTTCAGCTTGCATGCGCCGTGGGACGGGACAAAGCAGGATCCATTGCAATC
TTGAATCGGAATATCCAACCAAAGATCATTGGTCGTTTCGAGTTTCCTGAAGCACGCGGGTTCTGGACAATGTGT
GTGAAGAAGCCCATGCCAAAGTCGTTGGGAGCCACGGCGGCCGTGGGCAGCGACTATGACACGACGGCCCAATAC
GATAGGTATATGATTGTGGCAAAAGTTGATCTCGATGGCTATGAAACGTCTGATGTGTACGCGTTAAGAGCGGCT
GGTTTTGAAAGCCTCAAGGAGACAGAATTTGAGCCCGCTGCCGGCTTTACAGTCGAGGCCGGAGTCATGGGGAAA
CAAATGAGAATCATCCAGGTGCTCAAGTCCGAGGTTCGATGCTACGATGGCGACCTGGGACTGGCGCAGATCGTT
CCCATGTTGGACGAAGAAACGGGTGCTGAGCCTCGAGTGACGAGCGCCAGCATTGTCGATCCTTATCTGCTCTTG
ATTCGCGATGACGGGACCGTGTTTGTCGCGCAGATTGATGGCAACAACGAGCTCGACGAGATGGACAAGGCGGAC
AGTCCGCTACAGACAACCAAATGGACGGCAGGGTGTCTGTACAGCGACGCTCTGTGCACTTTCAGACCAGATGTT
GGCGACAAGGGAGTCGAGATTGGTGACAAGGTGCTCATGTTTTTGCTCAACTCTGCCGGAGCCCTACATATATAC
GAGCTGCCTGATGTTGCAAAGCCAGTTTTTGTAGCCGAGTGCCTTACGTCTATCCCCCCAATTCTCTCGGCAGAT
TATGCGGCCCGCCGAGGCGCCAGTCGTGAAACCGTGTCTGAGATTCTCGTGGCCGATCTTGGCGACACAGTGTCT
CAAGCACCTTATCTGATTGTACGGCATTGTACCGACGACTTGACCCTGTACGAGCCCATTCGATACGCTGGCAAC
GGCTCTTCGACCGGGCTGGAGGCGACGCTGGCCTTCAAAAAGTGTGCCAATGGCGTCTTGGCCCAGTACGCAGAT
GCAAGCCCACGCGATGAGAGCGAGCCACCGCGGTTTGTGCCTCTGCGGCGATGCGCCAACATTGGCGGCTTCAGC
ACCGTATTCTTGCCTGGGCCATGTCCAAGTTTTGTGCTCAAGAGCAGCAAGAGCATACCTCGGATAGTGGGACTT
GAAGGGCTGGGCGTGCGCGGCATGAGCACCTTTCACGCTGAGGGTTGTGATCGAGGCTTCATCTATGCCGACTCG
GAGGGCGTCGCAAGAGTTACACAGCTCCCAGCCGCGACCAATTTGGCCGAGTTTGGTCTTTCTGTCAAGAAGATT
GCGCTGGGTGGCGACGTGGACAAGATATCCTATCACCATCCTACTGGAACATATATTGCTGCGTGTACAGTCATG
GAGCCATTTGAACTTCCGCGCGACGACGATTATCACCGCGAATGGGCGAGGGAATCCTGCCGCCTTGCTCCGGCG
ATGCCGCGGGGCATGCTCAAGCTCATCAACCCAGCGACATGGACCGTCATCCACACAGTCGAAATGGAGTCGAGC
GAGTCTATTGAAAGCATGCGGACGCTTCTTCTCGAAGTGTCGGAGGAGACGCGGGAACGACGCATGCTACTTGCA
GTAGGCACCGCTCTATCCAAGGGCGAAGATCTGCCTACAAGGGGACGGGTGCAGGTGTTTGATATTGTCACAGTG
ATTCCAGAGTCCAATCGGCCAGAGACAAACCGGCGGCTCAAACTGATTGCCAAGGAAGACATTCCGCGCGGCGGC
GTGACGGCGCTGTCAGAAATTGGGCGGCAGGGCCTGATGCTGGTGGCACAGGGCCAGAAATGCATGGTGCGCGGA
CTCAAGGAGGACGGGTCTCTGCTCCCCGTCGCCTTTCTCGATATGAACTGTCACGTGGCGAGTATTCGCGAGTTA
CCTGGCACTGGGCTGTGTCTGCTGGCGGATGCCTTCAAGGGCCTCTGGTTCACGGGCTACACCGAGGAGCCATAC
ACGTTCAAGGTTCTGGGCAAGAGCAGTGGAAGATTACCACTGCTAGTGGCGGACTTTCTGCCTGATGGTGACGAT
TTGTCCATGGTGGCGGTGGACGCTGACGGCGACTTGCACATCTTTGAGTTTGATCCTGAGCATTCCAAGAGCTTG
CAGGGCCATATTCTCTTGCACCGAGCAACCTTTTCCGTCGCGCCAAACATAGCCACCACGACGCTCCTCCTACCA
CGCACCCTGCCTCCAAGCCACGCCAACCCTCAGCAGCAGCAGGGCGCCGCACCCACGCAACAGGCGCACATTCTC
CTTGTTGCGTCTCCATCGGGCCACCTCGCGGCCCTGACGCCGGTGCCTGAATCGACGTATCGCCGGCTGCTCTCG
GTAGCAAACCAGCTTGTGCCAGCGTTGCCTGCGCACGGCGGGCTGCACGCCAAGACGTTTCGCCTGCCCGACAGC
CAGCAGGCCGGCCGGGCGGCGCTGCCGGTTGGCGTGGACACGGGCGGCAGGGCAGTCGTGGACGGCGCTGTTTTG
GCGGCCTGGACGGCGCTGGGGGCGGCAAAGAGGGCCGAGGTGGCGGGCAAGGGCGGATATGACGGGGTGGGGGAT
CTGAGGGAGGATCTGCAGGCCTTGTTGGGCTGGCATAGCTTATCGTATTTCTAA
Transcript >OphauG2|3925
ATGCAAGTCTACACGGAGCTCGTGGCTCCCTCGGCCGTCACCCATTGTCTAAGCCTGTCTCTCACATCGTCGTCG
GCCACCAATCTTGTCGTCGCAAAAGGCTCGCTGCTGCAAATCTTCACCGTCAAATCCATCTCGGCCGAGCTCGAT
CCCCAGACCCACCAGGCCGACGAGGACACATCTAAACCCGACGCACACTTCGACCACCGTGCCAATGATGATGAT
GGCCTCGAGTCATCCTTTCTTGGAGGCGAGGTCATGCTGTTGCGTACCGACCGCTCAACCAATGCCAAGCTGGTC
CTCGTGGCCGAGCTTACTCTTGCTGGCACCGTCATCGGCCTGGCTCGTGTCAGGATCGCAAAGACAGCTTCAGGA
GGCGAGGGGCTGCTTATCGCCTACCGTGCCGCCAAGATGAGCCTCAACGAGTGGCATCCGCAGAGGGCCACGCTC
GAAACGACGTCGATCCACTTCTACGAAAAAGACGAGCTCATGGGTGTGCCTTGGGAGCTGCCCCTGAGCGACTAC
GTCAACTACCTAGAGGCTGATCCAGGGAGCCGATGCGCCGCTCTCAAATTCGGTTCCCGTAACCTGGCAATTCTG
CCTTTTGCTCAGTCGGAGCAGGATCTCGGCATGGACGACTGGGATGAGGATCTCGACGGACCACGTCCGCCCAAG
GAGGCCGCCACGCTGGCTGAGGGAGCTGATGGCAAGCTTGCACCTGCATATACGCCTTCATTTGTTTTGAGCCTT
CCTCTGCTCGACCCTACACTGCTCCATCCAATCCACCTTGCCTTTCTACACGAGTACCGCGAGCCGACATTTGGC
ATTCTTTCCGCAGTCCAGGCTCCTTCATCTGCCCTCGGACTCAAGGACAGTCTGTCCTACAAGGTGTTCACTCTG
GATCTTAAGCAGCGAGCTTCAACGACTATTTTATCTGTGACGGGCTTGCCTCAGGACCTCTTTCGAGTTGTTGCC
CTACCAGCGCCAATGGGCGGCGCTCTTCTTGTCGGTCTCAACGAGCTCATTCATATAGATCAATCTGGGAAGCCC
AACGGAGTGGCAGTCAATGATGTTGCAAAGCAAGCCACTTCTTTTAGCCTATCTGATCAGTCAGATCTCAACTGG
AGACTGGAACGCTGTGCCATTGAGCTCCTTGCCATTGATAACGGCGAGCTCCTGTTGGTTCTAAATGATGGCCGC
CTCGGCATCGTCAACTTCAAGATAGACGGACGCACTGTATCAGGAATTAGTGTCAAACCAGTGGCCCCAGACTGC
GGGGGACAATTGATCAGCAGCAGCGTCTCATGCATGTCGCGCCTTGATAGCAAATCTATTTTCGTCGGAAGCGGA
AGCGGAGATAGTGTCGTTCTGGGCTGGTCCAGGAAACAGAGCCAGGAAAAACGACAAAAGACACGTTTTCTAGAC
CCCGACTTGGGAATCGACATTGAGGACCTGGAATTGAGTGAGGATGATGATGACGACTTGTACGGCAACGATAAT
GTAGCAACTAAGACGTCTCAGGCCGCCAATGGCACAACAAAGCTTGGAGAGGTGATTTTCAAAATACAAGACACG
CTGCTTTGCATCGCACCGCTACTCGACATGACATGTGGAAGTCCAGCCCCGCTACCCGGCGCCGAAAGGGCTCAG
TTGGATCAGGGCGTATCAGCTCAGCTTCAGCTTGCATGCGCCGTGGGACGGGACAAAGCAGGATCCATTGCAATC
TTGAATCGGAATATCCAACCAAAGATCATTGGTCGTTTCGAGTTTCCTGAAGCACGCGGGTTCTGGACAATGTGT
GTGAAGAAGCCCATGCCAAAGTCGTTGGGAGCCACGGCGGCCGTGGGCAGCGACTATGACACGACGGCCCAATAC
GATAGGTATATGATTGTGGCAAAAGTTGATCTCGATGGCTATGAAACGTCTGATGTGTACGCGTTAAGAGCGGCT
GGTTTTGAAAGCCTCAAGGAGACAGAATTTGAGCCCGCTGCCGGCTTTACAGTCGAGGCCGGAGTCATGGGGAAA
CAAATGAGAATCATCCAGGTGCTCAAGTCCGAGGTTCGATGCTACGATGGCGACCTGGGACTGGCGCAGATCGTT
CCCATGTTGGACGAAGAAACGGGTGCTGAGCCTCGAGTGACGAGCGCCAGCATTGTCGATCCTTATCTGCTCTTG
ATTCGCGATGACGGGACCGTGTTTGTCGCGCAGATTGATGGCAACAACGAGCTCGACGAGATGGACAAGGCGGAC
AGTCCGCTACAGACAACCAAATGGACGGCAGGGTGTCTGTACAGCGACGCTCTGTGCACTTTCAGACCAGATGTT
GGCGACAAGGGAGTCGAGATTGGTGACAAGGTGCTCATGTTTTTGCTCAACTCTGCCGGAGCCCTACATATATAC
GAGCTGCCTGATGTTGCAAAGCCAGTTTTTGTAGCCGAGTGCCTTACGTCTATCCCCCCAATTCTCTCGGCAGAT
TATGCGGCCCGCCGAGGCGCCAGTCGTGAAACCGTGTCTGAGATTCTCGTGGCCGATCTTGGCGACACAGTGTCT
CAAGCACCTTATCTGATTGTACGGCATTGTACCGACGACTTGACCCTGTACGAGCCCATTCGATACGCTGGCAAC
GGCTCTTCGACCGGGCTGGAGGCGACGCTGGCCTTCAAAAAGTGTGCCAATGGCGTCTTGGCCCAGTACGCAGAT
GCAAGCCCACGCGATGAGAGCGAGCCACCGCGGTTTGTGCCTCTGCGGCGATGCGCCAACATTGGCGGCTTCAGC
ACCGTATTCTTGCCTGGGCCATGTCCAAGTTTTGTGCTCAAGAGCAGCAAGAGCATACCTCGGATAGTGGGACTT
GAAGGGCTGGGCGTGCGCGGCATGAGCACCTTTCACGCTGAGGGTTGTGATCGAGGCTTCATCTATGCCGACTCG
GAGGGCGTCGCAAGAGTTACACAGCTCCCAGCCGCGACCAATTTGGCCGAGTTTGGTCTTTCTGTCAAGAAGATT
GCGCTGGGTGGCGACGTGGACAAGATATCCTATCACCATCCTACTGGAACATATATTGCTGCGTGTACAGTCATG
GAGCCATTTGAACTTCCGCGCGACGACGATTATCACCGCGAATGGGCGAGGGAATCCTGCCGCCTTGCTCCGGCG
ATGCCGCGGGGCATGCTCAAGCTCATCAACCCAGCGACATGGACCGTCATCCACACAGTCGAAATGGAGTCGAGC
GAGTCTATTGAAAGCATGCGGACGCTTCTTCTCGAAGTGTCGGAGGAGACGCGGGAACGACGCATGCTACTTGCA
GTAGGCACCGCTCTATCCAAGGGCGAAGATCTGCCTACAAGGGGACGGGTGCAGGTGTTTGATATTGTCACAGTG
ATTCCAGAGTCCAATCGGCCAGAGACAAACCGGCGGCTCAAACTGATTGCCAAGGAAGACATTCCGCGCGGCGGC
GTGACGGCGCTGTCAGAAATTGGGCGGCAGGGCCTGATGCTGGTGGCACAGGGCCAGAAATGCATGGTGCGCGGA
CTCAAGGAGGACGGGTCTCTGCTCCCCGTCGCCTTTCTCGATATGAACTGTCACGTGGCGAGTATTCGCGAGTTA
CCTGGCACTGGGCTGTGTCTGCTGGCGGATGCCTTCAAGGGCCTCTGGTTCACGGGCTACACCGAGGAGCCATAC
ACGTTCAAGGTTCTGGGCAAGAGCAGTGGAAGATTACCACTGCTAGTGGCGGACTTTCTGCCTGATGGTGACGAT
TTGTCCATGGTGGCGGTGGACGCTGACGGCGACTTGCACATCTTTGAGTTTGATCCTGAGCATTCCAAGAGCTTG
CAGGGCCATATTCTCTTGCACCGAGCAACCTTTTCCGTCGCGCCAAACATAGCCACCACGACGCTCCTCCTACCA
CGCACCCTGCCTCCAAGCCACGCCAACCCTCAGCAGCAGCAGGGCGCCGCACCCACGCAACAGGCGCACATTCTC
CTTGTTGCGTCTCCATCGGGCCACCTCGCGGCCCTGACGCCGGTGCCTGAATCGACGTATCGCCGGCTGCTCTCG
GTAGCAAACCAGCTTGTGCCAGCGTTGCCTGCGCACGGCGGGCTGCACGCCAAGACGTTTCGCCTGCCCGACAGC
CAGCAGGCCGGCCGGGCGGCGCTGCCGGTTGGCGTGGACACGGGCGGCAGGGCAGTCGTGGACGGCGCTGTTTTG
GCGGCCTGGACGGCGCTGGGGGCGGCAAAGAGGGCCGAGGTGGCGGGCAAGGGCGGATATGACGGGGTGGGGGAT
CTGAGGGAGGATCTGCAGGCCTTGTTGGGCTGGCATAGCTTATCGTATTTCTAA
Gene >OphauG2|3925
ATGCAAGTCTACACGGAGCTCGTGGCTCCCTCGGCCGTCACCCATTGTCTAAGCCTGTCTCTCACATCGTCGTCG
GCCACCAATCTTGTCGTCGCAAAAGGCTCGCTGCTGCAAATCTTCACCGTCAAATCCATCTCGGCCGAGCTCGAT
CCCCAGACCCACCAGGCCGACGAGGACACATCTAAACCCGACGCACACTTCGACCACCGTGCCAATGATGATGAT
GGCCTCGAGTCATCCTTTCTTGGAGGCGAGGTCATGCTGTTGCGTACCGACCGCTCAACCAATGCCAAGCTGGTC
CTCGTGGCCGAGCTTACTCTTGCTGGCACCGTCATCGGCCTGGCTCGTGTCAGGATCGCAAAGACAGCTTCAGGA
GGCGAGGGGCTGCTTATCGCCTACCGTGCCGCCAAGATGAGCCTCAACGAGTGGCATCCGCAGAGGGCCACGCTC
GAAACGACGTCGATCCACTTCTACGAAAAAGACGAGCTCATGGGTGTGCCTTGGGAGCTGCCCCTGAGCGACTAC
GTCAACTACCTAGAGGCTGATCCAGGGAGCCGATGCGCCGCTCTCAAATTCGGTTCCCGTAACCTGGCAATTCTG
CCTTTTGCTCAGTCGGAGCAGGATCTCGGCATGGACGACTGGGATGAGGATCTCGACGGACCACGTCCGCCCAAG
GAGGCCGCCACGCTGGCTGAGGGAGCTGATGGCAAGCTTGCACCTGCATATACGCCTTCATTTGTTTTGAGCCTT
CCTCTGCTCGACCCTACACTGCTCCATCCAATCCACCTTGCCTTTCTACACGAGTACCGCGAGCCGACATTTGGC
ATTCTTTCCGCAGTCCAGGCTCCTTCATCTGCCCTCGGACTCAAGGACAGTCTGTCCTACAAGGTGTTCACTCTG
GATCTTAAGCAGCGAGCTTCAACGACTATTTTATCTGTGACGGGCTTGCCTCAGGACCTCTTTCGAGTTGTTGCC
CTACCAGCGCCAATGGGCGGCGCTCTTCTTGTCGGTCTCAACGAGCTCATTCATATAGATCAATCTGGGAAGCCC
AACGGAGTGGCAGTCAATGATGTTGCAAAGCAAGCCACTTCTTTTAGCCTATCTGATCAGTCAGATCTCAACTGG
AGACTGGAACGCTGTGCCATTGAGCTCCTTGCCATTGATAACGGCGAGCTCCTGTTGGTTCTAAATGATGGCCGC
CTCGGCATCGTCAACTTCAAGATAGACGGACGCACTGTATCAGGAATTAGTGTCAAACCAGTGGCCCCAGACTGC
GGGGGACAATTGATCAGCAGCAGCGTCTCATGCATGTCGCGCCTTGATAGCAAATCTATTTTCGTCGGAAGCGGA
AGCGGAGATAGTGTCGTTCTGGGCTGGTCCAGGAAACAGAGCCAGGAAAAACGACAAAAGACACGTTTTCTAGAC
CCCGACTTGGGAATCGACATTGAGGACCTGGAATTGAGTGAGGATGATGATGACGACTTGTACGGCAACGATAAT
GTAGCAACTAAGACGTCTCAGGCCGCCAATGGCACAACAAAGCTTGGAGAGGTGATTTTCAAAATACAAGACACG
CTGCTTTGCATCGCACCGCTACTCGACATGACATGTGGAAGTCCAGCCCCGCTACCCGGCGCCGAAAGGGCTCAG
TTGGATCAGGGCGTATCAGCTCAGCTTCAGCTTGCATGCGCCGTGGGACGGGACAAAGCAGGATCCATTGCAATC
TTGAATCGGAATATCCAACCAAAGATCATTGGTCGTTTCGAGTTTCCTGAAGCACGCGGGTTCTGGACAATGTGT
GTGAAGAAGCCCATGCCAAAGTCGTTGGGAGCCACGGCGGCCGTGGGCAGCGACTATGACACGACGGCCCAATAC
GATAGGTATATGATTGTGGCAAAAGTTGATCTCGATGGCTATGAAACGTCTGATGTGTACGCGTTAAGAGCGGCT
GGTTTTGAAAGCCTCAAGGAGACAGAATTTGAGCCCGCTGCCGGCTTTACAGTCGAGGCCGGAGTCATGGGGAAA
CAAATGAGAATCATCCAGGTGCTCAAGTCCGAGGTTCGATGCTACGATGGCGGTAAGCTTATGTCAAGCCCTAGT
TTCTTGTCAAGGCCATGACTGATTATAACAAGACCTGGGACTGGCGCAGATCGTTCCCATGTTGGACGAAGAAAC
GGGTGCTGAGCCTCGAGTGACGAGCGCCAGCATTGTCGATCCTTATCTGCTCTTGATTCGCGATGACGGGACCGT
GTTTGTCGCGCAGATTGATGGCAACAACGAGCTCGACGAGATGGACAAGGCGGACAGTCCGCTACAGACAACCAA
ATGGACGGCAGGGTGTCTGTACAGCGACGCTCTGTGCACTTTCAGACCAGATGTTGGCGACAAGGGAGTCGAGAT
TGGTGACAAGGTGCTCATGTTTTTGCTCAACTCTGCCGGAGCCCTACATGTGAGTCTTTTGTGAGAAGCGCTGCA
ACTGCAGCAAAGGGCTAACGAGGACCAGATATACGAGCTGCCTGATGTTGCAAAGCCAGTTTTTGTAGCCGAGTG
CCTTACGTCTATCCCCCCAATTCTCTCGGCAGATTATGCGGCCCGCCGAGGCGCCAGTCGTGAAACCGTGTCTGA
GATTCTCGTGGCCGATCTTGGCGACACAGTGTCTCAAGCACCTTATCTGATTGTAAGTATTTTTGCAGCAACGGC
TGACAAGGAAGCTAATGGTGGTCAAGGTACGGCATTGTACCGACGACTTGACCCTGTACGAGCCCATTCGATACG
CTGGCAACGGCTCTTCGACCGGGCTGGAGGCGACGCTGGCCTTCAAAAAGTGTGCCAATGGCGTCTTGGCCCAGT
ACGCAGATGCAAGCCCACGCGATGAGAGCGAGCCACCGCGGTTTGTGCCTCTGCGGCGATGCGCCAACATTGGCG
GCTTCAGCACCGTATTCTTGCCTGGGCCATGTCCAAGTTTTGTGCTCAAGAGCAGCAAGAGCATACCTCGGATAG
TGGGACTTGAAGGGCTGGGCGTGCGCGGCATGAGCACCTTTCACGCTGAGGGTTGTGATCGAGGCTTCATCTATG
CCGACTCGGAGGGCGTCGCAAGAGTTACACAGCTCCCAGCCGCGACCAATTTGGCCGAGTTTGGTCTTTCTGTCA
AGAAGATTGCGCTGGGTGGCGACGTGGACAAGATATCCTATCACCATCCTACTGGAACATATATTGCTGCGTGTA
CAGTCATGGAGCCATTTGAACTTCCGCGCGACGACGATTATCACCGCGAATGGGCGAGGGAATCCTGCCGCCTTG
CTCCGGCGATGCCGCGGGGCATGCTCAAGCTCATCAACCCAGCGACATGGACCGTCATCCACACAGTCGAAATGG
AGTCGAGCGAGTCTATTGAAAGCATGCGGACGCTTCTTCTCGAAGTGTCGGAGGAGACGCGGGAACGACGCATGC
TACTTGCAGTAGGCACCGCTCTATCCAAGGGCGAAGATCTGCCTACAAGGGGACGGGTGCAGGTGTTTGATATTG
TCACAGTGATTCCAGAGTCCAATCGGCCAGAGACAAACCGGCGGCTCAAACTGATTGCCAAGGAAGACATTCCGC
GCGGCGGCGTGACGGCGCTGTCAGAAATTGGGCGGCAGGGCCTGATGCTGGTGGCACAGGGCCAGAAATGCATGG
TGCGCGGACTCAAGGAGGACGGGTCTCTGCTCCCCGTCGCCTTTCTCGATATGAACTGTCACGTGGCGAGTATTC
GCGAGTTACCTGGCACTGGGCTGTGTCTGCTGGCGGATGCCTTCAAGGGCCTCTGGTTCACGGGCTACACCGAGG
AGCCATACACGTTCAAGGTTCTGGGCAAGAGCAGTGGAAGATTACCACTGCTAGTGGCGGACTTTCTGCCTGATG
GTGACGATTTGTCCATGGTGGCGGTGGACGCTGACGGCGACTTGCACATCTTTGAGTTTGATCCTGAGCGTAAGT
CTAGGAAGCCATGGCGGCTCGTGATGGAGATGGGAGACGAGGCTGATGAGAGAAACCAGATTCCAAGAGCTTGCA
GGGCCATATTCTCTTGCACCGAGCAACCTTTTCCGTCGCGCCAAACATAGCCACCACGACGCTCCTCCTACCACG
CACCCTGCCTCCAAGCCACGCCAACCCTCAGCAGCAGCAGGGCGCCGCACCCACGCAACAGGCGCACATTCTCCT
TGTTGCGTCTCCATCGGGCCACCTCGCGGCCCTGACGCCGGTGCCTGAATCGACGTATCGCCGGCTGCTCTCGGT
AGCAAACCAGCTTGTGCCAGCGTTGCCTGCGCACGGCGGGCTGCACGCCAAGACGTTTCGCCTGCCCGACAGCCA
GCAGGCCGGCCGGGCGGCGCTGCCGGTTGGCGTGGACACGGGCGGCAGGGCAGTCGTGGACGGCGCTGTTTTGGC
GGCCTGGACGGCGCTGGGGGCGGCAAAGAGGGCCGAGGTGGCGGGCAAGGGCGGATATGACGGGGTGGGGGATCT
GAGGGAGGATCTGCAGGCCTTGTTGGGCTGGCATAGCTTATCGTATTTCTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail