Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|3918
Gene name
LocationContig_308:12028..12851
Strand-
Gene length (bp)823
Transcript length (bp)744
Coding sequence length (bp)744
Protein length (aa) 248

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00466 Ribosomal_L10 Ribosomal protein L10 8.5E-20 18 121
PF17777 RL10P_insert Insertion domain in 60S ribosomal protein L10P 1.3E-19 126 214

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q7S302|MRT4_NEUCR Ribosome assembly factor mrt4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mrt4 PE=3 SV=1 1 238 2.0E-113
sp|G0S616|MRT4_CHATD Ribosome assembly factor mrt4 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) GN=CTHT_0025680 PE=1 SV=2 1 238 1.0E-109
sp|Q9USZ6|MRT4_SCHPO Ribosome assembly factor mrt4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mrt4 PE=3 SV=1 1 234 2.0E-63
sp|Q6FJ04|MRT4_CANGA Ribosome assembly factor mrt4 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=MRT4 PE=3 SV=1 1 238 1.0E-57
sp|P33201|MRT4_YEAST Ribosome assembly factor MRT4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRT4 PE=1 SV=1 1 234 6.0E-54
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q7S302|MRT4_NEUCR Ribosome assembly factor mrt4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mrt4 PE=3 SV=1 1 238 2.0E-113
sp|G0S616|MRT4_CHATD Ribosome assembly factor mrt4 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) GN=CTHT_0025680 PE=1 SV=2 1 238 1.0E-109
sp|Q9USZ6|MRT4_SCHPO Ribosome assembly factor mrt4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mrt4 PE=3 SV=1 1 234 2.0E-63
sp|Q6FJ04|MRT4_CANGA Ribosome assembly factor mrt4 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=MRT4 PE=3 SV=1 1 238 1.0E-57
sp|P33201|MRT4_YEAST Ribosome assembly factor MRT4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRT4 PE=1 SV=1 1 234 6.0E-54
sp|Q75DK9|MRT4_ASHGO Ribosome assembly factor mrt4 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=MRT4 PE=3 SV=1 1 237 1.0E-53
sp|Q9D0I8|MRT4_MOUSE mRNA turnover protein 4 homolog OS=Mus musculus GN=Mrto4 PE=1 SV=1 1 238 9.0E-49
sp|A4FV84|MRT4_BOVIN mRNA turnover protein 4 homolog OS=Bos taurus GN=MRTO4 PE=2 SV=1 1 237 4.0E-48
sp|Q9UKD2|MRT4_HUMAN mRNA turnover protein 4 homolog OS=Homo sapiens GN=MRTO4 PE=1 SV=2 1 237 3.0E-47
sp|Q86HD3|MRT4_DICDI Ribosome assembly factor mrt4 OS=Dictyostelium discoideum GN=mrt4 PE=3 SV=1 1 239 1.0E-37
sp|P15825|RL10_HALMA 50S ribosomal protein L10 OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=rpl10 PE=1 SV=2 21 197 3.0E-08
sp|B6YSX9|RL10_THEON 50S ribosomal protein L10 OS=Thermococcus onnurineus (strain NA1) GN=rpl10 PE=3 SV=1 21 227 4.0E-07
sp|P13553|RL10_HALSA 50S ribosomal protein L10 OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=rpl10 PE=3 SV=1 14 141 1.0E-06
sp|B0R4W1|RL10_HALS3 50S ribosomal protein L10 OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=rpl10 PE=3 SV=1 14 141 1.0E-06
sp|O74864|RLA0_SCHPO 60S acidic ribosomal protein P0 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpp0 PE=3 SV=1 19 227 8.0E-06
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4623
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3918 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|4148
Ophiocordyceps camponoti-floridani Ophcf2|04454
Ophiocordyceps camponoti-rufipedis Ophun1|1776
Ophiocordyceps kimflemingae Ophio5|7482
Ophiocordyceps subramaniannii Hirsu2|9708

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|3918
MPKSKRAKIVHLTQVSKKTRQHKDKLIDSIRDALPNYQHCLVIRVDNMRNTHLKDVRHDLASDSRLFFAKTKVMA
RALGSSESDAIASGIELLHKYLHGSVGILLSNRSPNDLVQYFENLTKVDFARAGVTASRSFTIPPGVVYATAGEV
PVEHDVPLEHTLEPELRRLGVPTRMVKGKIVLGDENGKGTGHLVCKQDQVLDSRQTRLLKLFGVCLSEFRVQVVA
YWSADTSQVTEVDTSGMDVEDA*
Coding >OphauG2|3918
ATGCCCAAGTCGAAGCGCGCAAAAATCGTTCACCTCACCCAAGTCTCGAAAAAGACTCGCCAACACAAGGACAAA
CTCATTGATTCCATCCGCGATGCCCTGCCCAACTATCAGCACTGCCTTGTCATTCGTGTGGACAACATGCGCAAC
ACGCACCTCAAAGACGTCCGCCACGACCTCGCCTCCGATTCTCGCCTCTTCTTTGCCAAGACCAAAGTCATGGCC
CGCGCACTCGGCTCCTCTGAGTCGGACGCCATTGCCTCGGGCATCGAGCTCCTACACAAATATCTTCACGGCTCT
GTCGGCATCCTTCTGTCCAACAGATCGCCCAACGACCTTGTCCAATATTTTGAGAACCTGACCAAGGTTGACTTT
GCCAGAGCTGGCGTGACAGCCTCGCGGTCATTTACTATCCCTCCTGGCGTTGTCTATGCAACCGCTGGCGAGGTT
CCAGTCGAACACGACGTGCCCCTCGAACACACTCTCGAACCTGAGCTTCGCAGGTTAGGCGTTCCCACACGCATG
GTCAAGGGTAAGATTGTCCTTGGGGATGAGAATGGCAAAGGTACTGGCCATCTTGTCTGTAAACAAGACCAAGTC
CTGGACTCTCGGCAAACTCGGCTGCTCAAGCTCTTTGGAGTCTGTCTAAGCGAGTTTCGAGTCCAAGTAGTAGCA
TATTGGAGTGCAGACACTAGTCAAGTCACAGAAGTTGATACGTCTGGAATGGATGTCGAAGATGCGTAG
Transcript >OphauG2|3918
ATGCCCAAGTCGAAGCGCGCAAAAATCGTTCACCTCACCCAAGTCTCGAAAAAGACTCGCCAACACAAGGACAAA
CTCATTGATTCCATCCGCGATGCCCTGCCCAACTATCAGCACTGCCTTGTCATTCGTGTGGACAACATGCGCAAC
ACGCACCTCAAAGACGTCCGCCACGACCTCGCCTCCGATTCTCGCCTCTTCTTTGCCAAGACCAAAGTCATGGCC
CGCGCACTCGGCTCCTCTGAGTCGGACGCCATTGCCTCGGGCATCGAGCTCCTACACAAATATCTTCACGGCTCT
GTCGGCATCCTTCTGTCCAACAGATCGCCCAACGACCTTGTCCAATATTTTGAGAACCTGACCAAGGTTGACTTT
GCCAGAGCTGGCGTGACAGCCTCGCGGTCATTTACTATCCCTCCTGGCGTTGTCTATGCAACCGCTGGCGAGGTT
CCAGTCGAACACGACGTGCCCCTCGAACACACTCTCGAACCTGAGCTTCGCAGGTTAGGCGTTCCCACACGCATG
GTCAAGGGTAAGATTGTCCTTGGGGATGAGAATGGCAAAGGTACTGGCCATCTTGTCTGTAAACAAGACCAAGTC
CTGGACTCTCGGCAAACTCGGCTGCTCAAGCTCTTTGGAGTCTGTCTAAGCGAGTTTCGAGTCCAAGTAGTAGCA
TATTGGAGTGCAGACACTAGTCAAGTCACAGAAGTTGATACGTCTGGAATGGATGTCGAAGATGCGTAG
Gene >OphauG2|3918
ATGCCCAAGTCGAAGCGCGCAAAAATCGTTCACCTCACCCAAGTCTCGAAAAAGACTCGCCAACACAAGGACAAA
CTCATTGATTCCATCCGCGATGCCCTGCCCAACTATCAGCACTGCCTTGTCATTCGTGTGGACAACATGCGCAAC
ACGCACCTCAAAGACGTCCGCCACGACCTCGCCTCCGATTCTCGCCTCTTCTTTGCCAAGACCAAAGTCATGGCC
CGCGCACTCGGCTCCTCTGAGTCGGACGCCATTGCCTCGGGCATCGAGCTCCTACACAAATATCTTCACGGCTCT
GTCGGCATCCTTCTGTCCAACAGATCGCCCAACGACCTTGTCCAATATTTTGAGAACCTGACCAAGGTTGACTTT
GCCAGAGCTGGCGTGACAGCCTCGCGGTCATTTACTATCCCTCCTGGCGTTGTCTATGCAACCGCTGGCGAGGTT
CCAGTCGAACACGACGTGCCCCTCGAACACACTCTCGAACCTGAGCTTCGCAGGTTAGGCGTTCCCACACGCATG
GTCAAGGGTAAGATTGTCCTTGGGGATGAGAATGGCAAAGGTACTGGCCATCTTGTCTGTAAACAAGACCAAGTC
CTGGACTCTCGGCAAACTCGGCTGCTCAAGCTCTTTGGAGTCTGTCTAAGCGAGTTTCGAGTCCAAGTAGTAGCG
TACGTTCTTTCTCTCTCTTTCTATCCCCAAATCCCTTGCTCGGCTTCCATCTCTTCGGCCCCCCTAACATTGTTT
CAGATATTGGAGTGCAGACACTAGTCAAGTCACAGAAGTTGATACGTCTGGAATGGATGTCGAAGATGCGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail