Protein ID | OphauG2|3906 |
Gene name | |
Location | Contig_307:5159..6002 |
Strand | + |
Gene length (bp) | 843 |
Transcript length (bp) | 843 |
Coding sequence length (bp) | 843 |
Protein length (aa) | 281 |
PFAM Domain ID | Short name | Long name | E-value | Start | End |
---|---|---|---|---|---|
PF00573 | Ribosomal_L4 | Ribosomal protein L4/L1 family | 1.0E-40 | 48 | 248 |
Swissprot ID | Swissprot Description | Start | End | E-value |
---|---|---|---|---|
sp|P51998|RL4P_YEAST | 54S ribosomal protein YmL6, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YML6 PE=1 SV=1 | 1 | 260 | 5.0E-32 |
sp|O74801|RL4P_SCHPO | 54S ribosomal protein yml6, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=yml6 PE=3 SV=1 | 27 | 159 | 2.0E-30 |
sp|Q3ZZM3|RL4_DEHMC | 50S ribosomal protein L4 OS=Dehalococcoides mccartyi (strain CBDB1) GN=rplD PE=3 SV=1 | 34 | 248 | 2.0E-22 |
sp|A5FRZ0|RL4_DEHMB | 50S ribosomal protein L4 OS=Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1) GN=rplD PE=3 SV=1 | 34 | 248 | 2.0E-22 |
sp|Q3Z980|RL4_DEHM1 | 50S ribosomal protein L4 OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=rplD PE=3 SV=1 | 50 | 159 | 3.0E-22 |
Swissprot ID | Swissprot Description | Start | End | E-value |
---|---|---|---|---|
sp|P51998|RL4P_YEAST | 54S ribosomal protein YmL6, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YML6 PE=1 SV=1 | 1 | 260 | 5.0E-32 |
sp|O74801|RL4P_SCHPO | 54S ribosomal protein yml6, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=yml6 PE=3 SV=1 | 27 | 159 | 2.0E-30 |
sp|Q3ZZM3|RL4_DEHMC | 50S ribosomal protein L4 OS=Dehalococcoides mccartyi (strain CBDB1) GN=rplD PE=3 SV=1 | 34 | 248 | 2.0E-22 |
sp|A5FRZ0|RL4_DEHMB | 50S ribosomal protein L4 OS=Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1) GN=rplD PE=3 SV=1 | 34 | 248 | 2.0E-22 |
sp|Q3Z980|RL4_DEHM1 | 50S ribosomal protein L4 OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=rplD PE=3 SV=1 | 50 | 159 | 3.0E-22 |
sp|A1WVC1|RL4_HALHL | 50S ribosomal protein L4 OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=rplD PE=3 SV=1 | 44 | 246 | 4.0E-22 |
sp|Q11QB3|RL4_CYTH3 | 50S ribosomal protein L4 OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=rplD PE=3 SV=1 | 68 | 240 | 9.0E-22 |
sp|A9BHA4|RL4_PETMO | 50S ribosomal protein L4 OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=rplD PE=3 SV=1 | 55 | 159 | 1.0E-21 |
sp|Q6AP70|RL4_DESPS | 50S ribosomal protein L4 OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=rplD PE=3 SV=1 | 56 | 152 | 2.0E-21 |
sp|A6GZ98|RL4_FLAPJ | 50S ribosomal protein L4 OS=Flavobacterium psychrophilum (strain JIP02/86 / ATCC 49511) GN=rplD PE=3 SV=1 | 67 | 165 | 4.0E-21 |
sp|Q3A6P6|RL4_PELCD | 50S ribosomal protein L4 OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=rplD PE=3 SV=1 | 38 | 248 | 7.0E-21 |
sp|C0ZII1|RL4_BREBN | 50S ribosomal protein L4 OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=rplD PE=3 SV=1 | 56 | 245 | 2.0E-20 |
sp|A5FMY0|RL4_FLAJ1 | 50S ribosomal protein L4 OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=rplD PE=3 SV=1 | 67 | 165 | 4.0E-20 |
sp|C4KZP5|RL4_EXISA | 50S ribosomal protein L4 OS=Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b) GN=rplD PE=3 SV=1 | 56 | 245 | 9.0E-20 |
sp|A0M597|RL4_GRAFK | 50S ribosomal protein L4 OS=Gramella forsetii (strain KT0803) GN=rplD PE=3 SV=1 | 67 | 245 | 9.0E-20 |
sp|B3EUM2|RL4_AMOA5 | 50S ribosomal protein L4 OS=Amoebophilus asiaticus (strain 5a2) GN=rplD PE=3 SV=1 | 67 | 159 | 1.0E-19 |
sp|B9K887|RL4_THENN | 50S ribosomal protein L4 OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=rplD PE=3 SV=1 | 55 | 152 | 1.0E-19 |
sp|Q7MTL4|RL4_PORGI | 50S ribosomal protein L4 OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=rplD PE=3 SV=1 | 67 | 159 | 1.0E-19 |
sp|B0C1D4|RL4_ACAM1 | 50S ribosomal protein L4 OS=Acaryochloris marina (strain MBIC 11017) GN=rplD PE=3 SV=1 | 56 | 245 | 2.0E-19 |
sp|B2RLZ1|RL4_PORG3 | 50S ribosomal protein L4 OS=Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / JCM 12257) GN=rplD PE=3 SV=1 | 67 | 159 | 3.0E-19 |
sp|C5BQ62|RL4_TERTT | 50S ribosomal protein L4 OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=rplD PE=3 SV=1 | 52 | 248 | 3.0E-19 |
sp|Q3A9R7|RL4_CARHZ | 50S ribosomal protein L4 OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=rplD PE=3 SV=1 | 51 | 202 | 6.0E-19 |
sp|B3PK38|RL4_CELJU | 50S ribosomal protein L4 OS=Cellvibrio japonicus (strain Ueda107) GN=rplD PE=3 SV=1 | 52 | 167 | 6.0E-19 |
sp|B6YQ84|RL4_AZOPC | 50S ribosomal protein L4 OS=Azobacteroides pseudotrichonymphae genomovar. CFP2 GN=rplD PE=3 SV=1 | 67 | 159 | 7.0E-19 |
sp|P61067|RL4_ONYPE | 50S ribosomal protein L4 OS=Onion yellows phytoplasma (strain OY-M) GN=rplD PE=3 SV=1 | 38 | 165 | 9.0E-19 |
sp|B3QZZ2|RL4_PHYMT | 50S ribosomal protein L4 OS=Phytoplasma mali (strain AT) GN=rplD PE=3 SV=1 | 50 | 242 | 1.0E-18 |
sp|Q9FA03|RL4_BRAPL | 50S ribosomal protein L4 OS=Brachyspira pilosicoli GN=rplD PE=3 SV=1 | 52 | 159 | 1.0E-18 |
sp|P51313|RK4_PORPU | 50S ribosomal protein L4, chloroplastic OS=Porphyra purpurea GN=rpl4 PE=3 SV=1 | 48 | 141 | 1.0E-18 |
sp|C0QVZ7|RL4_BRAHW | 50S ribosomal protein L4 OS=Brachyspira hyodysenteriae (strain ATCC 49526 / WA1) GN=rplD PE=3 SV=1 | 52 | 159 | 2.0E-18 |
sp|B1HMX9|RL4_LYSSC | 50S ribosomal protein L4 OS=Lysinibacillus sphaericus (strain C3-41) GN=rplD PE=3 SV=1 | 56 | 248 | 2.0E-18 |
sp|Q64NK9|RL4_BACFR | 50S ribosomal protein L4 OS=Bacteroides fragilis (strain YCH46) GN=rplD PE=3 SV=1 | 67 | 159 | 2.0E-18 |
sp|Q5L8B0|RL4_BACFN | 50S ribosomal protein L4 OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=rplD PE=3 SV=1 | 67 | 159 | 2.0E-18 |
sp|Q8DMN0|RL4_THEEB | 50S ribosomal protein L4 OS=Thermosynechococcus elongatus (strain BP-1) GN=rplD PE=3 SV=1 | 56 | 155 | 2.0E-18 |
sp|B7K334|RL4_CYAP8 | 50S ribosomal protein L4 OS=Cyanothece sp. (strain PCC 8801) GN=rplD PE=3 SV=1 | 56 | 152 | 2.0E-18 |
sp|A6LEJ0|RL4_PARD8 | 50S ribosomal protein L4 OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / NCTC 11152) GN=rplD PE=3 SV=1 | 67 | 152 | 2.0E-18 |
sp|Q1XDH5|RK4_PYRYE | 50S ribosomal protein L4, chloroplastic OS=Pyropia yezoensis GN=rpl4 PE=3 SV=1 | 48 | 141 | 3.0E-18 |
sp|B6EPS6|RL4_ALISL | 50S ribosomal protein L4 OS=Aliivibrio salmonicida (strain LFI1238) GN=rplD PE=3 SV=1 | 56 | 248 | 3.0E-18 |
sp|P61070|RL4_TREDE | 50S ribosomal protein L4 OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=rplD PE=3 SV=1 | 50 | 152 | 5.0E-18 |
sp|Q8A477|RL4_BACTN | 50S ribosomal protein L4 OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=rplD PE=3 SV=1 | 67 | 159 | 6.0E-18 |
sp|B1I1I9|RL4_DESAP | 50S ribosomal protein L4 OS=Desulforudis audaxviator (strain MP104C) GN=rplD PE=3 SV=1 | 51 | 245 | 6.0E-18 |
sp|Q01W93|RL4_SOLUE | 50S ribosomal protein L4 OS=Solibacter usitatus (strain Ellin6076) GN=rplD PE=3 SV=1 | 32 | 212 | 7.0E-18 |
sp|B0TC57|RL4_HELMI | 50S ribosomal protein L4 OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=rplD PE=3 SV=1 | 56 | 201 | 7.0E-18 |
sp|P73319|RL4_SYNY3 | 50S ribosomal protein L4 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=rplD PE=3 SV=1 | 56 | 141 | 7.0E-18 |
sp|Q2NIV5|RL4_AYWBP | 50S ribosomal protein L4 OS=Aster yellows witches'-broom phytoplasma (strain AYWB) GN=rplD PE=3 SV=1 | 38 | 165 | 7.0E-18 |
sp|B7KHY8|RL4_CYAP7 | 50S ribosomal protein L4 OS=Cyanothece sp. (strain PCC 7424) GN=rplD PE=3 SV=1 | 56 | 152 | 8.0E-18 |
sp|B4S092|RL4_ALTMD | 50S ribosomal protein L4 OS=Alteromonas macleodii (strain DSM 17117 / Deep ecotype) GN=rplD1 PE=3 SV=1 | 56 | 248 | 1.0E-17 |
sp|B1VAE7|RL4_PHYAS | 50S ribosomal protein L4 OS=Phytoplasma australiense GN=rplD PE=3 SV=1 | 57 | 206 | 1.0E-17 |
sp|Q87T12|RL4_VIBPA | 50S ribosomal protein L4 OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=rplD PE=3 SV=1 | 56 | 248 | 1.0E-17 |
sp|Q8RIF6|RL4_FUSNN | 50S ribosomal protein L4 OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=rplD PE=3 SV=1 | 56 | 245 | 1.0E-17 |
sp|C3LRQ7|RL4_VIBCM | 50S ribosomal protein L4 OS=Vibrio cholerae serotype O1 (strain M66-2) GN=rplD PE=3 SV=1 | 56 | 232 | 1.0E-17 |
sp|Q9KNY5|RL4_VIBCH | 50S ribosomal protein L4 OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=rplD PE=3 SV=1 | 56 | 232 | 1.0E-17 |
sp|A5F548|RL4_VIBC3 | 50S ribosomal protein L4 OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=rplD PE=3 SV=1 | 56 | 232 | 1.0E-17 |
sp|B1MW13|RL4_LEUCK | 50S ribosomal protein L4 OS=Leuconostoc citreum (strain KM20) GN=rplD PE=3 SV=1 | 56 | 159 | 2.0E-17 |
sp|P55836|RL4_AGGAC | 50S ribosomal protein L4 OS=Aggregatibacter actinomycetemcomitans GN=rplD PE=3 SV=1 | 56 | 231 | 2.0E-17 |
sp|O24690|RL4_SYNP6 | 50S ribosomal protein L4 OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=rplD PE=3 SV=1 | 56 | 155 | 2.0E-17 |
sp|Q31L08|RL4_SYNE7 | 50S ribosomal protein L4 OS=Synechococcus elongatus (strain PCC 7942) GN=rplD PE=3 SV=1 | 56 | 155 | 2.0E-17 |
sp|Q5ZYP2|RL4_LEGPH | 50S ribosomal protein L4 OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=rplD PE=3 SV=1 | 56 | 152 | 2.0E-17 |
sp|B0UX14|RL4_HISS2 | 50S ribosomal protein L4 OS=Histophilus somni (strain 2336) GN=rplD PE=3 SV=1 | 56 | 232 | 2.0E-17 |
sp|A6KYJ4|RL4_BACV8 | 50S ribosomal protein L4 OS=Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / NCTC 11154) GN=rplD PE=3 SV=1 | 67 | 165 | 2.0E-17 |
sp|Q1MPR2|RL4_LAWIP | 50S ribosomal protein L4 OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=rplD PE=3 SV=1 | 42 | 152 | 2.0E-17 |
sp|Q3MFC0|RL4_ANAVT | 50S ribosomal protein L4 OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=rplD PE=3 SV=1 | 56 | 152 | 2.0E-17 |
sp|Q5WZL1|RL4_LEGPL | 50S ribosomal protein L4 OS=Legionella pneumophila (strain Lens) GN=rplD PE=3 SV=1 | 56 | 152 | 2.0E-17 |
sp|C6C186|RL4_DESAD | 50S ribosomal protein L4 OS=Desulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIB 8403 / VKM B-1763) GN=rplD PE=3 SV=1 | 48 | 161 | 2.0E-17 |
sp|Q034Y4|RL4_LACC3 | 50S ribosomal protein L4 OS=Lactobacillus casei (strain ATCC 334) GN=rplD PE=3 SV=1 | 55 | 248 | 2.0E-17 |
sp|A5IHR3|RL4_LEGPC | 50S ribosomal protein L4 OS=Legionella pneumophila (strain Corby) GN=rplD PE=3 SV=1 | 56 | 152 | 2.0E-17 |
sp|B2ITQ4|RL4_NOSP7 | 50S ribosomal protein L4 OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=rplD PE=3 SV=1 | 56 | 152 | 2.0E-17 |
sp|Q0I162|RL4_HAES1 | 50S ribosomal protein L4 OS=Haemophilus somnus (strain 129Pt) GN=rplD PE=3 SV=1 | 56 | 232 | 2.0E-17 |
sp|B8F756|RL4_HAEPS | 50S ribosomal protein L4 OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=rplD PE=3 SV=1 | 56 | 232 | 2.0E-17 |
sp|A1TYJ8|RL4_MARHV | 50S ribosomal protein L4 OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=rplD PE=3 SV=1 | 56 | 159 | 2.0E-17 |
sp|A4ST05|RL4_AERS4 | 50S ribosomal protein L4 OS=Aeromonas salmonicida (strain A449) GN=rplD PE=3 SV=1 | 56 | 232 | 2.0E-17 |
sp|B0BST2|RL4_ACTPJ | 50S ribosomal protein L4 OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=rplD PE=3 SV=1 | 56 | 232 | 2.0E-17 |
sp|B3GZ12|RL4_ACTP7 | 50S ribosomal protein L4 OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=rplD PE=3 SV=1 | 56 | 232 | 2.0E-17 |
sp|A3N359|RL4_ACTP2 | 50S ribosomal protein L4 OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=rplD PE=3 SV=1 | 56 | 232 | 2.0E-17 |
sp|Q5SHN9|RL4_THET8 | 50S ribosomal protein L4 OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=rplD PE=1 SV=1 | 27 | 241 | 2.0E-17 |
sp|A0KF22|RL4_AERHH | 50S ribosomal protein L4 OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=rplD PE=3 SV=1 | 56 | 232 | 2.0E-17 |
sp|Q21M56|RL4_SACD2 | 50S ribosomal protein L4 OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=rplD PE=3 SV=1 | 52 | 167 | 2.0E-17 |
sp|B5FG10|RL4_VIBFM | 50S ribosomal protein L4 OS=Vibrio fischeri (strain MJ11) GN=rplD PE=3 SV=1 | 56 | 248 | 3.0E-17 |
sp|Q5E8B4|RL4_VIBF1 | 50S ribosomal protein L4 OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=rplD PE=3 SV=1 | 56 | 248 | 3.0E-17 |
sp|B2S2D7|RL4_TREPS | 50S ribosomal protein L4 OS=Treponema pallidum subsp. pallidum (strain SS14) GN=rplD PE=3 SV=1 | 34 | 168 | 3.0E-17 |
sp|O83220|RL4_TREPA | 50S ribosomal protein L4 OS=Treponema pallidum (strain Nichols) GN=rplD PE=3 SV=1 | 34 | 168 | 3.0E-17 |
sp|B8HMQ5|RL4_CYAP4 | 50S ribosomal protein L4 OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=rplD PE=3 SV=1 | 56 | 155 | 3.0E-17 |
sp|B8GV57|RL4_THISH | 50S ribosomal protein L4 OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=rplD PE=3 SV=1 | 44 | 159 | 3.0E-17 |
sp|B7VLF6|RL4_VIBTL | 50S ribosomal protein L4 OS=Vibrio tasmaniensis (strain LGP32) GN=rplD PE=3 SV=1 | 56 | 240 | 3.0E-17 |
sp|Q4K534|RL4_PSEF5 | 50S ribosomal protein L4 OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=rplD PE=3 SV=1 | 56 | 152 | 3.0E-17 |
sp|B1YGV1|RL4_EXIS2 | 50S ribosomal protein L4 OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=rplD PE=3 SV=1 | 56 | 245 | 3.0E-17 |
sp|Q65QV6|RL4_MANSM | 50S ribosomal protein L4 OS=Mannheimia succiniciproducens (strain MBEL55E) GN=rplD PE=3 SV=1 | 56 | 232 | 3.0E-17 |
sp|Q2S913|RL4_HAHCH | 50S ribosomal protein L4 OS=Hahella chejuensis (strain KCTC 2396) GN=rplD PE=3 SV=1 | 69 | 159 | 3.0E-17 |
sp|Q9CL33|RL4_PASMU | 50S ribosomal protein L4 OS=Pasteurella multocida (strain Pm70) GN=rplD PE=3 SV=1 | 56 | 232 | 3.0E-17 |
sp|A6TWI1|RL4_ALKMQ | 50S ribosomal protein L4 OS=Alkaliphilus metalliredigens (strain QYMF) GN=rplD PE=3 SV=1 | 36 | 248 | 3.0E-17 |
sp|Q72I05|RL4_THET2 | 50S ribosomal protein L4 OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=rplD PE=1 SV=1 | 56 | 241 | 3.0E-17 |
sp|Q2RFP8|RL4_MOOTA | 50S ribosomal protein L4 OS=Moorella thermoacetica (strain ATCC 39073) GN=rplD PE=3 SV=1 | 56 | 245 | 3.0E-17 |
sp|Q5X858|RL4_LEGPA | 50S ribosomal protein L4 OS=Legionella pneumophila (strain Paris) GN=rplD PE=3 SV=1 | 56 | 152 | 3.0E-17 |
sp|Q6CZX1|RL4_PECAS | 50S ribosomal protein L4 OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=rplD PE=3 SV=1 | 56 | 240 | 3.0E-17 |
sp|A7GK21|RL4_BACCN | 50S ribosomal protein L4 OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=rplD PE=3 SV=1 | 56 | 248 | 4.0E-17 |
sp|C0Q9X2|RL4_DESAH | 50S ribosomal protein L4 OS=Desulfobacterium autotrophicum (strain ATCC 43914 / DSM 3382 / HRM2) GN=rplD PE=3 SV=1 | 36 | 165 | 5.0E-17 |
sp|Q7MPI7|RL4_VIBVY | 50S ribosomal protein L4 OS=Vibrio vulnificus (strain YJ016) GN=rplD PE=3 SV=1 | 56 | 240 | 5.0E-17 |
sp|Q8DE40|RL4_VIBVU | 50S ribosomal protein L4 OS=Vibrio vulnificus (strain CMCP6) GN=rplD PE=3 SV=1 | 56 | 240 | 5.0E-17 |
sp|Q7VKD3|RL4_HAEDU | 50S ribosomal protein L4 OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=rplD PE=3 SV=1 | 56 | 232 | 5.0E-17 |
sp|Q8YPI0|RL4_NOSS1 | 50S ribosomal protein L4 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=rplD PE=3 SV=1 | 56 | 152 | 6.0E-17 |
sp|A7HM51|RL4_FERNB | 50S ribosomal protein L4 OS=Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1) GN=rplD PE=3 SV=1 | 55 | 248 | 7.0E-17 |
sp|Q67JU4|RL4_SYMTH | 50S ribosomal protein L4 OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=rplD PE=3 SV=1 | 56 | 245 | 7.0E-17 |
sp|B1JDW3|RL4_PSEPW | 50S ribosomal protein L4 OS=Pseudomonas putida (strain W619) GN=rplD PE=3 SV=1 | 56 | 152 | 7.0E-17 |
sp|Q88QN4|RL4_PSEPK | 50S ribosomal protein L4 OS=Pseudomonas putida (strain KT2440) GN=rplD PE=3 SV=1 | 56 | 152 | 7.0E-17 |
sp|B0KK68|RL4_PSEPG | 50S ribosomal protein L4 OS=Pseudomonas putida (strain GB-1) GN=rplD PE=3 SV=1 | 56 | 152 | 7.0E-17 |
sp|A5VXP8|RL4_PSEP1 | 50S ribosomal protein L4 OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=rplD PE=3 SV=1 | 56 | 152 | 7.0E-17 |
sp|Q3K5Y9|RL4_PSEPF | 50S ribosomal protein L4 OS=Pseudomonas fluorescens (strain Pf0-1) GN=rplD PE=3 SV=1 | 56 | 152 | 8.0E-17 |
sp|B8FET4|RL4_DESAA | 50S ribosomal protein L4 OS=Desulfatibacillum alkenivorans (strain AK-01) GN=rplD PE=3 SV=1 | 34 | 156 | 8.0E-17 |
sp|Q1IFW5|RL4_PSEE4 | 50S ribosomal protein L4 OS=Pseudomonas entomophila (strain L48) GN=rplD PE=3 SV=1 | 56 | 152 | 8.0E-17 |
sp|C6E4Q6|RL4_GEOSM | 50S ribosomal protein L4 OS=Geobacter sp. (strain M21) GN=rplD PE=3 SV=1 | 52 | 161 | 8.0E-17 |
sp|B5EFQ1|RL4_GEOBB | 50S ribosomal protein L4 OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=rplD PE=3 SV=1 | 52 | 161 | 8.0E-17 |
sp|C3K2X5|RL4_PSEFS | 50S ribosomal protein L4 OS=Pseudomonas fluorescens (strain SBW25) GN=rplD PE=3 SV=1 | 56 | 152 | 8.0E-17 |
sp|Q110A8|RL4_TRIEI | 50S ribosomal protein L4 OS=Trichodesmium erythraeum (strain IMS101) GN=rplD PE=3 SV=1 | 56 | 171 | 8.0E-17 |
sp|A6W391|RL4_MARMS | 50S ribosomal protein L4 OS=Marinomonas sp. (strain MWYL1) GN=rplD PE=3 SV=1 | 69 | 167 | 9.0E-17 |
sp|Q6LVB5|RL4_PHOPR | 50S ribosomal protein L4 OS=Photobacterium profundum GN=rplD PE=3 SV=1 | 56 | 248 | 1.0E-16 |
sp|A9KJJ3|RL4_CLOPH | 50S ribosomal protein L4 OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=rplD PE=3 SV=1 | 50 | 174 | 1.0E-16 |
sp|B7V645|RL4_PSEA8 | 50S ribosomal protein L4 OS=Pseudomonas aeruginosa (strain LESB58) GN=rplD PE=3 SV=1 | 56 | 232 | 1.0E-16 |
sp|P44345|RL4_HAEIN | 50S ribosomal protein L4 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=rplD PE=3 SV=1 | 56 | 232 | 1.0E-16 |
sp|A5UHT1|RL4_HAEIG | 50S ribosomal protein L4 OS=Haemophilus influenzae (strain PittGG) GN=rplD PE=3 SV=1 | 56 | 232 | 1.0E-16 |
sp|A5UDU6|RL4_HAEIE | 50S ribosomal protein L4 OS=Haemophilus influenzae (strain PittEE) GN=rplD PE=3 SV=1 | 56 | 232 | 1.0E-16 |
sp|Q4QMC1|RL4_HAEI8 | 50S ribosomal protein L4 OS=Haemophilus influenzae (strain 86-028NP) GN=rplD PE=3 SV=1 | 56 | 232 | 1.0E-16 |
sp|Q9HWD6|RL4_PSEAE | 50S ribosomal protein L4 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=rplD PE=3 SV=1 | 56 | 232 | 1.0E-16 |
sp|Q02T79|RL4_PSEAB | 50S ribosomal protein L4 OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=rplD PE=3 SV=1 | 56 | 232 | 1.0E-16 |
sp|A6UZI9|RL4_PSEA7 | 50S ribosomal protein L4 OS=Pseudomonas aeruginosa (strain PA7) GN=rplD PE=3 SV=1 | 56 | 232 | 1.0E-16 |
sp|Q5QXZ1|RL4_IDILO | 50S ribosomal protein L4 OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=rplD PE=3 SV=1 | 56 | 232 | 1.0E-16 |
sp|A4J112|RL4_DESRM | 50S ribosomal protein L4 OS=Desulfotomaculum reducens (strain MI-1) GN=rplD PE=3 SV=1 | 56 | 159 | 1.0E-16 |
sp|A8MLE1|RL4_ALKOO | 50S ribosomal protein L4 OS=Alkaliphilus oremlandii (strain OhILAs) GN=rplD PE=3 SV=1 | 36 | 248 | 1.0E-16 |
sp|Q2LQA0|RL4_SYNAS | 50S ribosomal protein L4 OS=Syntrophus aciditrophicus (strain SB) GN=rplD PE=3 SV=1 | 56 | 152 | 1.0E-16 |
sp|B0JI02|RL4_MICAN | 50S ribosomal protein L4 OS=Microcystis aeruginosa (strain NIES-843) GN=rplD PE=3 SV=1 | 56 | 138 | 1.0E-16 |
sp|P49665|RL4_THETH | 50S ribosomal protein L4 OS=Thermus thermophilus GN=rplD PE=3 SV=2 | 27 | 241 | 1.0E-16 |
sp|A9VP78|RL4_BACWK | 50S ribosomal protein L4 OS=Bacillus weihenstephanensis (strain KBAB4) GN=rplD PE=3 SV=1 | 56 | 248 | 2.0E-16 |
sp|B7GJ68|RL4_ANOFW | 50S ribosomal protein L4 OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=rplD PE=3 SV=1 | 56 | 248 | 2.0E-16 |
sp|A6VLI9|RL4_ACTSZ | 50S ribosomal protein L4 OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=rplD PE=3 SV=1 | 56 | 232 | 2.0E-16 |
sp|A7MWI4|RL4_VIBCB | 50S ribosomal protein L4 OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=rplD PE=3 SV=1 | 56 | 248 | 2.0E-16 |
sp|A8ZV58|RL4_DESOH | 50S ribosomal protein L4 OS=Desulfococcus oleovorans (strain DSM 6200 / Hxd3) GN=rplD PE=3 SV=1 | 36 | 157 | 2.0E-16 |
sp|C6DG73|RL4_PECCP | 50S ribosomal protein L4 OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=rplD PE=3 SV=1 | 56 | 240 | 2.0E-16 |
sp|Q48D37|RL4_PSE14 | 50S ribosomal protein L4 OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=rplD PE=3 SV=1 | 56 | 152 | 2.0E-16 |
sp|A0LIJ1|RL4_SYNFM | 50S ribosomal protein L4 OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=rplD PE=3 SV=1 | 50 | 150 | 2.0E-16 |
sp|Q0SN28|RL4_BORAP | 50S ribosomal protein L4 OS=Borrelia afzelii (strain PKo) GN=rplD PE=3 SV=1 | 57 | 141 | 2.0E-16 |
sp|B3WAL6|RL4_LACCB | 50S ribosomal protein L4 OS=Lactobacillus casei (strain BL23) GN=rplD PE=3 SV=1 | 55 | 248 | 2.0E-16 |
sp|Q4ZMP5|RL4_PSEU2 | 50S ribosomal protein L4 OS=Pseudomonas syringae pv. syringae (strain B728a) GN=rplD PE=3 SV=1 | 56 | 152 | 2.0E-16 |
sp|Q889X0|RL4_PSESM | 50S ribosomal protein L4 OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=rplD PE=3 SV=1 | 56 | 152 | 2.0E-16 |
sp|B2GDW8|RL4_LACF3 | 50S ribosomal protein L4 OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=rplD PE=3 SV=1 | 58 | 245 | 2.0E-16 |
sp|Q03ZP4|RL4_LEUMM | 50S ribosomal protein L4 OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=rplD PE=3 SV=1 | 56 | 159 | 2.0E-16 |
sp|A1JS46|RL4_YERE8 | 50S ribosomal protein L4 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=rplD PE=3 SV=1 | 56 | 240 | 2.0E-16 |
sp|Q6HPQ7|RL4_BACHK | 50S ribosomal protein L4 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=rplD PE=3 SV=1 | 56 | 248 | 2.0E-16 |
sp|Q63H89|RL4_BACCZ | 50S ribosomal protein L4 OS=Bacillus cereus (strain ZK / E33L) GN=rplD PE=3 SV=1 | 56 | 248 | 2.0E-16 |
sp|Q81J41|RL4_BACCR | 50S ribosomal protein L4 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=rplD PE=3 SV=1 | 56 | 248 | 2.0E-16 |
sp|B9IZJ5|RL4_BACCQ | 50S ribosomal protein L4 OS=Bacillus cereus (strain Q1) GN=rplD PE=3 SV=1 | 56 | 248 | 2.0E-16 |
sp|B7HQU5|RL4_BACC7 | 50S ribosomal protein L4 OS=Bacillus cereus (strain AH187) GN=rplD PE=3 SV=1 | 56 | 248 | 2.0E-16 |
sp|B7HJ49|RL4_BACC4 | 50S ribosomal protein L4 OS=Bacillus cereus (strain B4264) GN=rplD PE=3 SV=1 | 56 | 248 | 2.0E-16 |
sp|C1ET40|RL4_BACC3 | 50S ribosomal protein L4 OS=Bacillus cereus (strain 03BB102) GN=rplD PE=3 SV=1 | 56 | 248 | 2.0E-16 |
sp|B7IT20|RL4_BACC2 | 50S ribosomal protein L4 OS=Bacillus cereus (strain G9842) GN=rplD PE=3 SV=1 | 56 | 248 | 2.0E-16 |
sp|Q73F95|RL4_BACC1 | 50S ribosomal protein L4 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=rplD PE=3 SV=1 | 56 | 248 | 2.0E-16 |
sp|B7JKC0|RL4_BACC0 | 50S ribosomal protein L4 OS=Bacillus cereus (strain AH820) GN=rplD PE=3 SV=1 | 56 | 248 | 2.0E-16 |
sp|Q81VS9|RL4_BACAN | 50S ribosomal protein L4 OS=Bacillus anthracis GN=rplD PE=3 SV=1 | 56 | 248 | 2.0E-16 |
sp|A0R8I1|RL4_BACAH | 50S ribosomal protein L4 OS=Bacillus thuringiensis (strain Al Hakam) GN=rplD PE=3 SV=1 | 56 | 248 | 2.0E-16 |
sp|C3LJ83|RL4_BACAC | 50S ribosomal protein L4 OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=rplD PE=3 SV=1 | 56 | 248 | 2.0E-16 |
sp|C3P9Q6|RL4_BACAA | 50S ribosomal protein L4 OS=Bacillus anthracis (strain A0248) GN=rplD PE=3 SV=1 | 56 | 248 | 2.0E-16 |
sp|Q661E2|RL4_BORBP | 50S ribosomal protein L4 OS=Borrelia bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi) GN=rplD PE=3 SV=1 | 57 | 141 | 3.0E-16 |
sp|P94268|RL4_BORBU | 50S ribosomal protein L4 OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=rplD PE=3 SV=2 | 57 | 141 | 3.0E-16 |
sp|A8ESU4|RL4_ARCB4 | 50S ribosomal protein L4 OS=Arcobacter butzleri (strain RM4018) GN=rplD PE=3 SV=1 | 37 | 168 | 3.0E-16 |
sp|B7J244|RL4_BORBZ | 50S ribosomal protein L4 OS=Borrelia burgdorferi (strain ZS7) GN=rplD PE=3 SV=1 | 57 | 141 | 3.0E-16 |
sp|B1JIW2|RL4_YERPY | 50S ribosomal protein L4 OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=rplD PE=3 SV=1 | 56 | 248 | 4.0E-16 |
sp|P60731|RL4_YERPS | 50S ribosomal protein L4 OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=rplD PE=3 SV=1 | 56 | 248 | 4.0E-16 |
sp|A4TGZ3|RL4_YERPP | 50S ribosomal protein L4 OS=Yersinia pestis (strain Pestoides F) GN=rplD PE=3 SV=1 | 56 | 248 | 4.0E-16 |
sp|Q1CCU5|RL4_YERPN | 50S ribosomal protein L4 OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=rplD PE=3 SV=1 | 56 | 248 | 4.0E-16 |
sp|A9R8Z7|RL4_YERPG | 50S ribosomal protein L4 OS=Yersinia pestis bv. Antiqua (strain Angola) GN=rplD PE=3 SV=1 | 56 | 248 | 4.0E-16 |
sp|P60730|RL4_YERPE | 50S ribosomal protein L4 OS=Yersinia pestis GN=rplD PE=3 SV=1 | 56 | 248 | 4.0E-16 |
sp|B2K5M9|RL4_YERPB | 50S ribosomal protein L4 OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=rplD PE=3 SV=1 | 56 | 248 | 4.0E-16 |
sp|Q1C2U8|RL4_YERPA | 50S ribosomal protein L4 OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=rplD PE=3 SV=1 | 56 | 248 | 4.0E-16 |
sp|A7FNN4|RL4_YERP3 | 50S ribosomal protein L4 OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=rplD PE=3 SV=1 | 56 | 248 | 4.0E-16 |
sp|B3EGY9|RL4_CHLL2 | 50S ribosomal protein L4 OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=rplD PE=3 SV=1 | 67 | 248 | 4.0E-16 |
sp|A9NED4|RL4_ACHLI | 50S ribosomal protein L4 OS=Acholeplasma laidlawii (strain PG-8A) GN=rplD PE=3 SV=1 | 54 | 246 | 4.0E-16 |
sp|Q83PY4|RL4_SHIFL | 50S ribosomal protein L4 OS=Shigella flexneri GN=rplD PE=3 SV=1 | 56 | 240 | 5.0E-16 |
sp|Q0SZY4|RL4_SHIF8 | 50S ribosomal protein L4 OS=Shigella flexneri serotype 5b (strain 8401) GN=rplD PE=3 SV=1 | 56 | 240 | 5.0E-16 |
sp|A4IJJ0|RL4_GEOTN | 50S ribosomal protein L4 OS=Geobacillus thermodenitrificans (strain NG80-2) GN=rplD PE=3 SV=1 | 56 | 248 | 5.0E-16 |
sp|O52333|RL4_MYCGA | 50S ribosomal protein L4 OS=Mycoplasma gallisepticum (strain R(low / passage 15 / clone 2)) GN=rplD PE=3 SV=1 | 54 | 249 | 5.0E-16 |
sp|Q30Z43|RL4_DESAG | 50S ribosomal protein L4 OS=Desulfovibrio alaskensis (strain G20) GN=rplD PE=3 SV=1 | 48 | 151 | 5.0E-16 |
sp|B2A4E0|RL4_NATTJ | 50S ribosomal protein L4 OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=rplD PE=3 SV=1 | 52 | 152 | 5.0E-16 |
sp|B5RPI3|RL4_BORRA | 50S ribosomal protein L4 OS=Borrelia recurrentis (strain A1) GN=rplD PE=3 SV=1 | 57 | 139 | 5.0E-16 |
sp|B5RM37|RL4_BORDL | 50S ribosomal protein L4 OS=Borrelia duttonii (strain Ly) GN=rplD PE=3 SV=1 | 57 | 139 | 5.0E-16 |
sp|Q65PA6|RL4_BACLD | 50S ribosomal protein L4 OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=rplD PE=3 SV=1 | 56 | 248 | 5.0E-16 |
sp|Q7MYF2|RL4_PHOLL | 50S ribosomal protein L4 OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=rplD PE=3 SV=1 | 56 | 240 | 5.0E-16 |
sp|Q0AUI1|RL4_SYNWW | 50S ribosomal protein L4 OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=rplD PE=3 SV=1 | 56 | 201 | 5.0E-16 |
sp|A1VEB5|RL4_DESVV | 50S ribosomal protein L4 OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=rplD PE=3 SV=1 | 46 | 161 | 6.0E-16 |
sp|Q72CH9|RL4_DESVH | 50S ribosomal protein L4 OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=rplD PE=3 SV=1 | 46 | 161 | 6.0E-16 |
sp|B2G8X7|RL4_LACRJ | 50S ribosomal protein L4 OS=Lactobacillus reuteri (strain JCM 1112) GN=rplD PE=3 SV=1 | 55 | 245 | 6.0E-16 |
sp|A5VLK4|RL4_LACRD | 50S ribosomal protein L4 OS=Lactobacillus reuteri (strain DSM 20016) GN=rplD PE=3 SV=1 | 55 | 245 | 6.0E-16 |
sp|Q8ETY1|RL4_OCEIH | 50S ribosomal protein L4 OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=rplD PE=3 SV=1 | 56 | 224 | 6.0E-16 |
sp|O46895|RK4_GUITH | 50S ribosomal protein L4, chloroplastic OS=Guillardia theta GN=rpl4 PE=3 SV=1 | 25 | 128 | 6.0E-16 |
sp|C1CXG5|RL4_DEIDV | 50S ribosomal protein L4 OS=Deinococcus deserti (strain VCD115 / DSM 17065 / LMG 22923) GN=rplD PE=3 SV=1 | 45 | 157 | 6.0E-16 |
sp|Q2NQM3|RL4_SODGM | 50S ribosomal protein L4 OS=Sodalis glossinidius (strain morsitans) GN=rplD PE=3 SV=1 | 56 | 240 | 7.0E-16 |
sp|Q5L3Z6|RL4_GEOKA | 50S ribosomal protein L4 OS=Geobacillus kaustophilus (strain HTA426) GN=rplD PE=3 SV=1 | 56 | 248 | 8.0E-16 |
sp|B3QR77|RL4_CHLP8 | 50S ribosomal protein L4 OS=Chlorobaculum parvum (strain NCIB 8327) GN=rplD PE=3 SV=1 | 67 | 152 | 8.0E-16 |
sp|Q15YN8|RL4_PSEA6 | 50S ribosomal protein L4 OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=rplD PE=3 SV=1 | 56 | 151 | 8.0E-16 |
sp|P28601|RL4_GEOSE | 50S ribosomal protein L4 OS=Geobacillus stearothermophilus GN=rplD PE=1 SV=1 | 56 | 248 | 8.0E-16 |
sp|A9KD30|RL4_COXBN | 50S ribosomal protein L4 OS=Coxiella burnetii (strain Dugway 5J108-111) GN=rplD PE=3 SV=1 | 69 | 159 | 9.0E-16 |
sp|A1BJ33|RL4_CHLPD | 50S ribosomal protein L4 OS=Chlorobium phaeobacteroides (strain DSM 266) GN=rplD PE=3 SV=1 | 67 | 152 | 1.0E-15 |
sp|Q3YWU0|RL4_SHISS | 50S ribosomal protein L4 OS=Shigella sonnei (strain Ss046) GN=rplD PE=3 SV=1 | 56 | 240 | 1.0E-15 |
sp|Q32B32|RL4_SHIDS | 50S ribosomal protein L4 OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=rplD PE=3 SV=1 | 56 | 240 | 1.0E-15 |
sp|Q31VV7|RL4_SHIBS | 50S ribosomal protein L4 OS=Shigella boydii serotype 4 (strain Sb227) GN=rplD PE=3 SV=1 | 56 | 240 | 1.0E-15 |
sp|B2U2T7|RL4_SHIB3 | 50S ribosomal protein L4 OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=rplD PE=3 SV=1 | 56 | 240 | 1.0E-15 |
sp|P60726|RL4_SALTY | 50S ribosomal protein L4 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=rplD PE=1 SV=1 | 56 | 240 | 1.0E-15 |
sp|P60727|RL4_SALTI | 50S ribosomal protein L4 OS=Salmonella typhi GN=rplD PE=3 SV=1 | 56 | 240 | 1.0E-15 |
sp|B4TXE1|RL4_SALSV | 50S ribosomal protein L4 OS=Salmonella schwarzengrund (strain CVM19633) GN=rplD PE=3 SV=1 | 56 | 240 | 1.0E-15 |
sp|B5BGY5|RL4_SALPK | 50S ribosomal protein L4 OS=Salmonella paratyphi A (strain AKU_12601) GN=rplD PE=3 SV=1 | 56 | 240 | 1.0E-15 |
sp|C0Q0B5|RL4_SALPC | 50S ribosomal protein L4 OS=Salmonella paratyphi C (strain RKS4594) GN=rplD PE=3 SV=1 | 56 | 240 | 1.0E-15 |
sp|Q5PIV3|RL4_SALPA | 50S ribosomal protein L4 OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=rplD PE=3 SV=1 | 56 | 240 | 1.0E-15 |
sp|B4SUT9|RL4_SALNS | 50S ribosomal protein L4 OS=Salmonella newport (strain SL254) GN=rplD PE=3 SV=1 | 56 | 240 | 1.0E-15 |
sp|B4TKL4|RL4_SALHS | 50S ribosomal protein L4 OS=Salmonella heidelberg (strain SL476) GN=rplD PE=3 SV=1 | 56 | 240 | 1.0E-15 |
sp|B5RH16|RL4_SALG2 | 50S ribosomal protein L4 OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=rplD PE=3 SV=1 | 56 | 240 | 1.0E-15 |
sp|B5R290|RL4_SALEP | 50S ribosomal protein L4 OS=Salmonella enteritidis PT4 (strain P125109) GN=rplD PE=3 SV=1 | 56 | 240 | 1.0E-15 |
sp|B5FJL3|RL4_SALDC | 50S ribosomal protein L4 OS=Salmonella dublin (strain CT_02021853) GN=rplD PE=3 SV=1 | 56 | 240 | 1.0E-15 |
sp|Q57J33|RL4_SALCH | 50S ribosomal protein L4 OS=Salmonella choleraesuis (strain SC-B67) GN=rplD PE=3 SV=1 | 56 | 240 | 1.0E-15 |
sp|A9MN48|RL4_SALAR | 50S ribosomal protein L4 OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=rplD PE=3 SV=1 | 56 | 240 | 1.0E-15 |
sp|B5F8F1|RL4_SALA4 | 50S ribosomal protein L4 OS=Salmonella agona (strain SL483) GN=rplD PE=3 SV=1 | 56 | 240 | 1.0E-15 |
sp|B7LRT5|RL4_ESCF3 | 50S ribosomal protein L4 OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=rplD PE=3 SV=1 | 56 | 240 | 1.0E-15 |
sp|Q1R604|RL4_ECOUT | 50S ribosomal protein L4 OS=Escherichia coli (strain UTI89 / UPEC) GN=rplD PE=3 SV=1 | 56 | 240 | 1.0E-15 |
sp|B1LHD3|RL4_ECOSM | 50S ribosomal protein L4 OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=rplD PE=3 SV=1 | 56 | 240 | 1.0E-15 |
sp|B6I233|RL4_ECOSE | 50S ribosomal protein L4 OS=Escherichia coli (strain SE11) GN=rplD PE=3 SV=1 | 56 | 240 | 1.0E-15 |
sp|B7NDU0|RL4_ECOLU | 50S ribosomal protein L4 OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=rplD PE=3 SV=1 | 56 | 240 | 1.0E-15 |
sp|P60723|RL4_ECOLI | 50S ribosomal protein L4 OS=Escherichia coli (strain K12) GN=rplD PE=1 SV=1 | 56 | 240 | 1.0E-15 |
sp|B1IPY0|RL4_ECOLC | 50S ribosomal protein L4 OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=rplD PE=3 SV=1 | 56 | 240 | 1.0E-15 |
sp|P60724|RL4_ECOL6 | 50S ribosomal protein L4 OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=rplD PE=3 SV=1 | 56 | 240 | 1.0E-15 |
sp|Q0TCE2|RL4_ECOL5 | 50S ribosomal protein L4 OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=rplD PE=3 SV=1 | 56 | 240 | 1.0E-15 |
sp|A1AGK6|RL4_ECOK1 | 50S ribosomal protein L4 OS=Escherichia coli O1:K1 / APEC GN=rplD PE=3 SV=1 | 56 | 240 | 1.0E-15 |
sp|A8A5C4|RL4_ECOHS | 50S ribosomal protein L4 OS=Escherichia coli O9:H4 (strain HS) GN=rplD PE=3 SV=1 | 56 | 240 | 1.0E-15 |
sp|B1X6H0|RL4_ECODH | 50S ribosomal protein L4 OS=Escherichia coli (strain K12 / DH10B) GN=rplD PE=3 SV=1 | 56 | 240 | 1.0E-15 |
sp|C4ZUH4|RL4_ECOBW | 50S ribosomal protein L4 OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=rplD PE=3 SV=1 | 56 | 240 | 1.0E-15 |
sp|B7M1N3|RL4_ECO8A | 50S ribosomal protein L4 OS=Escherichia coli O8 (strain IAI1) GN=rplD PE=3 SV=1 | 56 | 240 | 1.0E-15 |
sp|B7N1A3|RL4_ECO81 | 50S ribosomal protein L4 OS=Escherichia coli O81 (strain ED1a) GN=rplD PE=3 SV=1 | 56 | 240 | 1.0E-15 |
sp|B7NLN8|RL4_ECO7I | 50S ribosomal protein L4 OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=rplD PE=3 SV=1 | 56 | 240 | 1.0E-15 |
sp|B5YTP0|RL4_ECO5E | 50S ribosomal protein L4 OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=rplD PE=3 SV=1 | 56 | 240 | 1.0E-15 |
sp|P60725|RL4_ECO57 | 50S ribosomal protein L4 OS=Escherichia coli O157:H7 GN=rplD PE=3 SV=1 | 56 | 240 | 1.0E-15 |
sp|B7L4K8|RL4_ECO55 | 50S ribosomal protein L4 OS=Escherichia coli (strain 55989 / EAEC) GN=rplD PE=3 SV=1 | 56 | 240 | 1.0E-15 |
sp|B7MCT4|RL4_ECO45 | 50S ribosomal protein L4 OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=rplD PE=3 SV=1 | 56 | 240 | 1.0E-15 |
sp|B7UK43|RL4_ECO27 | 50S ribosomal protein L4 OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=rplD PE=3 SV=1 | 56 | 240 | 1.0E-15 |
sp|A7ZSK8|RL4_ECO24 | 50S ribosomal protein L4 OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=rplD PE=3 SV=1 | 56 | 240 | 1.0E-15 |
sp|A7MPH8|RL4_CROS8 | 50S ribosomal protein L4 OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=rplD PE=3 SV=1 | 56 | 240 | 1.0E-15 |
sp|A8AQL8|RL4_CITK8 | 50S ribosomal protein L4 OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=rplD PE=3 SV=1 | 56 | 240 | 1.0E-15 |
sp|A4WFC7|RL4_ENT38 | 50S ribosomal protein L4 OS=Enterobacter sp. (strain 638) GN=rplD PE=3 SV=1 | 56 | 240 | 1.0E-15 |
sp|A8GKJ6|RL4_SERP5 | 50S ribosomal protein L4 OS=Serratia proteamaculans (strain 568) GN=rplD PE=3 SV=1 | 56 | 240 | 1.0E-15 |
sp|Q0VSK2|RL4_ALCBS | 50S ribosomal protein L4 OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=rplD PE=3 SV=1 | 69 | 231 | 1.0E-15 |
sp|C4L7T1|RL4_TOLAT | 50S ribosomal protein L4 OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=rplD PE=3 SV=1 | 56 | 232 | 1.0E-15 |
sp|B2VK63|RL4_ERWT9 | 50S ribosomal protein L4 OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=rplD PE=3 SV=1 | 56 | 240 | 1.0E-15 |
sp|A0L5X4|RL4_MAGMM | 50S ribosomal protein L4 OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=rplD PE=3 SV=1 | 52 | 248 | 1.0E-15 |
sp|Q1LTD7|RL4_BAUCH | 50S ribosomal protein L4 OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=rplD PE=3 SV=1 | 56 | 151 | 1.0E-15 |
sp|A6TEX1|RL4_KLEP7 | 50S ribosomal protein L4 OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=rplD PE=3 SV=1 | 56 | 240 | 2.0E-15 |
sp|B5XN95|RL4_KLEP3 | 50S ribosomal protein L4 OS=Klebsiella pneumoniae (strain 342) GN=rplD PE=3 SV=1 | 56 | 240 | 2.0E-15 |
sp|Q1QDI5|RL4_PSYCK | 50S ribosomal protein L4 OS=Psychrobacter cryohalolentis (strain K5) GN=rplD PE=3 SV=1 | 69 | 240 | 2.0E-15 |
sp|Q03PV8|RL4_LACBA | 50S ribosomal protein L4 OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=rplD PE=3 SV=1 | 53 | 228 | 2.0E-15 |
sp|A5D5J1|RL4_PELTS | 50S ribosomal protein L4 OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=rplD PE=3 SV=1 | 56 | 245 | 2.0E-15 |
sp|C4K7B7|RL4_HAMD5 | 50S ribosomal protein L4 OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=rplD PE=3 SV=1 | 56 | 248 | 2.0E-15 |
sp|B4F1I5|RL4_PROMH | 50S ribosomal protein L4 OS=Proteus mirabilis (strain HI4320) GN=rplD PE=3 SV=1 | 56 | 151 | 2.0E-15 |
sp|A4XLS9|RL4_CALS8 | 50S ribosomal protein L4 OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=rplD PE=3 SV=1 | 48 | 251 | 2.0E-15 |
sp|B9MKI0|RL4_CALBD | 50S ribosomal protein L4 OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=rplD PE=3 SV=1 | 48 | 251 | 2.0E-15 |
sp|Q7UN19|RL4_RHOBA | 50S ribosomal protein L4 OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=rplD PE=3 SV=1 | 42 | 159 | 2.0E-15 |
sp|Q8K951|RL4_BUCAP | 50S ribosomal protein L4 OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=rplD PE=3 SV=1 | 25 | 232 | 2.0E-15 |
sp|B6IRQ7|RL4_RHOCS | 50S ribosomal protein L4 OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=rplD PE=3 SV=1 | 50 | 151 | 3.0E-15 |
sp|Q1BDA6|RL4_MYCSS | 50S ribosomal protein L4 OS=Mycobacterium sp. (strain MCS) GN=rplD PE=3 SV=1 | 56 | 160 | 3.0E-15 |
sp|A1UBN7|RL4_MYCSK | 50S ribosomal protein L4 OS=Mycobacterium sp. (strain KMS) GN=rplD PE=3 SV=1 | 56 | 160 | 3.0E-15 |
sp|A3PVC2|RL4_MYCSJ | 50S ribosomal protein L4 OS=Mycobacterium sp. (strain JLS) GN=rplD PE=3 SV=1 | 56 | 160 | 3.0E-15 |
sp|Q6GEI4|RL4_STAAR | 50S ribosomal protein L4 OS=Staphylococcus aureus (strain MRSA252) GN=rplD PE=3 SV=1 | 56 | 159 | 3.0E-15 |
sp|A3Q983|RL4_SHELP | 50S ribosomal protein L4 OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=rplD PE=3 SV=1 | 56 | 151 | 3.0E-15 |
sp|Q1R0H4|RL4_CHRSD | 50S ribosomal protein L4 OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=rplD PE=3 SV=1 | 56 | 167 | 3.0E-15 |
sp|B8D848|RL4_BUCAT | 50S ribosomal protein L4 OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7) GN=rplD PE=3 SV=1 | 56 | 232 | 3.0E-15 |
sp|P57590|RL4_BUCAI | 50S ribosomal protein L4 OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=rplD PE=3 SV=1 | 56 | 232 | 3.0E-15 |
sp|C5D3R8|RL4_GEOSW | 50S ribosomal protein L4 OS=Geobacillus sp. (strain WCH70) GN=rplD PE=3 SV=1 | 56 | 248 | 3.0E-15 |
sp|B8D9U6|RL4_BUCA5 | 50S ribosomal protein L4 OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A) GN=rplD PE=3 SV=1 | 56 | 232 | 3.0E-15 |
sp|P61060|RL4_STAAW | 50S ribosomal protein L4 OS=Staphylococcus aureus (strain MW2) GN=rplD PE=3 SV=1 | 56 | 159 | 3.0E-15 |
sp|Q6G772|RL4_STAAS | 50S ribosomal protein L4 OS=Staphylococcus aureus (strain MSSA476) GN=rplD PE=3 SV=1 | 56 | 159 | 3.0E-15 |
sp|P61059|RL4_STAAN | 50S ribosomal protein L4 OS=Staphylococcus aureus (strain N315) GN=rplD PE=1 SV=1 | 56 | 159 | 3.0E-15 |
sp|P61058|RL4_STAAM | 50S ribosomal protein L4 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=rplD PE=3 SV=1 | 56 | 159 | 3.0E-15 |
sp|A6QJ91|RL4_STAAE | 50S ribosomal protein L4 OS=Staphylococcus aureus (strain Newman) GN=rplD PE=3 SV=1 | 56 | 159 | 3.0E-15 |
sp|Q5HDV9|RL4_STAAC | 50S ribosomal protein L4 OS=Staphylococcus aureus (strain COL) GN=rplD PE=3 SV=1 | 56 | 159 | 3.0E-15 |
sp|Q2YYP7|RL4_STAAB | 50S ribosomal protein L4 OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=rplD PE=3 SV=1 | 56 | 159 | 3.0E-15 |
sp|A5IV33|RL4_STAA9 | 50S ribosomal protein L4 OS=Staphylococcus aureus (strain JH9) GN=rplD PE=3 SV=1 | 56 | 159 | 3.0E-15 |
sp|Q2FW07|RL4_STAA8 | 50S ribosomal protein L4 OS=Staphylococcus aureus (strain NCTC 8325) GN=rplD PE=1 SV=1 | 56 | 159 | 3.0E-15 |
sp|Q2FEP0|RL4_STAA3 | 50S ribosomal protein L4 OS=Staphylococcus aureus (strain USA300) GN=rplD PE=3 SV=1 | 56 | 159 | 3.0E-15 |
sp|A6U3X4|RL4_STAA2 | 50S ribosomal protein L4 OS=Staphylococcus aureus (strain JH1) GN=rplD PE=3 SV=1 | 56 | 159 | 3.0E-15 |
sp|A7X5G2|RL4_STAA1 | 50S ribosomal protein L4 OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=rplD PE=3 SV=1 | 56 | 159 | 3.0E-15 |
sp|C5BGM4|RL4_EDWI9 | 50S ribosomal protein L4 OS=Edwardsiella ictaluri (strain 93-146) GN=rplD PE=3 SV=1 | 56 | 151 | 3.0E-15 |
sp|Q7V541|RL4_PROMM | 50S ribosomal protein L4 OS=Prochlorococcus marinus (strain MIT 9313) GN=rplD PE=3 SV=1 | 55 | 180 | 4.0E-15 |
sp|B1KMY2|RL4_SHEWM | 50S ribosomal protein L4 OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=rplD PE=3 SV=1 | 56 | 151 | 4.0E-15 |
sp|Q49ZG7|RL4_STAS1 | 50S ribosomal protein L4 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=rplD PE=3 SV=1 | 55 | 159 | 4.0E-15 |
sp|Q83ES3|RL4_COXBU | 50S ribosomal protein L4 OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=rplD PE=3 SV=1 | 69 | 159 | 4.0E-15 |
sp|A9NAM5|RL4_COXBR | 50S ribosomal protein L4 OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=rplD PE=3 SV=1 | 69 | 159 | 4.0E-15 |
sp|B1LBN9|RL4_THESQ | 50S ribosomal protein L4 OS=Thermotoga sp. (strain RQ2) GN=rplD PE=3 SV=1 | 55 | 200 | 5.0E-15 |
sp|A5IM84|RL4_THEP1 | 50S ribosomal protein L4 OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=rplD PE=3 SV=1 | 55 | 200 | 5.0E-15 |
sp|A4FPM4|RL4_SACEN | 50S ribosomal protein L4 OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=rplD PE=3 SV=1 | 56 | 160 | 5.0E-15 |
sp|A8F986|RL4_BACP2 | 50S ribosomal protein L4 OS=Bacillus pumilus (strain SAFR-032) GN=rplD PE=3 SV=1 | 56 | 201 | 5.0E-15 |
sp|Q7NPG9|RL4_GLOVI | 50S ribosomal protein L4 OS=Gloeobacter violaceus (strain PCC 7421) GN=rplD PE=3 SV=1 | 56 | 240 | 5.0E-15 |
sp|C5CGR3|RL4_KOSOT | 50S ribosomal protein L4 OS=Kosmotoga olearia (strain TBF 19.5.1) GN=rplD PE=3 SV=1 | 55 | 248 | 5.0E-15 |
sp|B0TM11|RL4_SHEHH | 50S ribosomal protein L4 OS=Shewanella halifaxensis (strain HAW-EB4) GN=rplD PE=3 SV=1 | 56 | 155 | 5.0E-15 |
sp|B9M6U4|RL4_GEODF | 50S ribosomal protein L4 OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=rplD PE=3 SV=1 | 52 | 254 | 5.0E-15 |
sp|P49226|RL4_MORMO | 50S ribosomal protein L4 OS=Morganella morganii GN=rplD PE=3 SV=1 | 56 | 151 | 5.0E-15 |
sp|P9WH85|RL4_MYCTU | 50S ribosomal protein L4 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=rplD PE=1 SV=1 | 48 | 160 | 6.0E-15 |
sp|P9WH84|RL4_MYCTO | 50S ribosomal protein L4 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=rplD PE=3 SV=1 | 48 | 160 | 6.0E-15 |
sp|A5U088|RL4_MYCTA | 50S ribosomal protein L4 OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=rplD PE=3 SV=1 | 48 | 160 | 6.0E-15 |
sp|C1AL36|RL4_MYCBT | 50S ribosomal protein L4 OS=Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) GN=rplD PE=3 SV=1 | 48 | 160 | 6.0E-15 |
sp|A1KGI3|RL4_MYCBP | 50S ribosomal protein L4 OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=rplD PE=3 SV=1 | 48 | 160 | 6.0E-15 |
sp|P60728|RL4_MYCBO | 50S ribosomal protein L4 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=rplD PE=3 SV=1 | 48 | 160 | 6.0E-15 |
sp|A8G1E7|RL4_SHESH | 50S ribosomal protein L4 OS=Shewanella sediminis (strain HAW-EB3) GN=rplD PE=3 SV=1 | 56 | 151 | 6.0E-15 |
sp|A8GYX7|RL4_SHEPA | 50S ribosomal protein L4 OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=rplD PE=3 SV=1 | 56 | 232 | 6.0E-15 |
sp|O66432|RL4_AQUAE | 50S ribosomal protein L4 OS=Aquifex aeolicus (strain VF5) GN=rplD PE=3 SV=1 | 48 | 245 | 6.0E-15 |
sp|Q3IF24|RL4_PSEHT | 50S ribosomal protein L4 OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=rplD PE=3 SV=1 | 56 | 151 | 6.0E-15 |
sp|Q6KI54|RL4_MYCMO | 50S ribosomal protein L4 OS=Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711) GN=rplD PE=3 SV=1 | 57 | 209 | 6.0E-15 |
sp|B8CND4|RL4_SHEPW | 50S ribosomal protein L4 OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=rplD PE=3 SV=1 | 56 | 232 | 7.0E-15 |
sp|Q2G8X9|RL4_NOVAD | 50S ribosomal protein L4 OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=rplD PE=3 SV=1 | 44 | 157 | 7.0E-15 |
sp|A9BCP6|RL4_PROM4 | 50S ribosomal protein L4 OS=Prochlorococcus marinus (strain MIT 9211) GN=rplD PE=3 SV=1 | 55 | 152 | 7.0E-15 |
sp|A4VHN1|RL4_PSEU5 | 50S ribosomal protein L4 OS=Pseudomonas stutzeri (strain A1501) GN=rplD PE=3 SV=1 | 56 | 152 | 7.0E-15 |
sp|Q2RQW1|RL4_RHORT | 50S ribosomal protein L4 OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=rplD PE=3 SV=1 | 50 | 154 | 7.0E-15 |
sp|Q4FUF5|RL4_PSYA2 | 50S ribosomal protein L4 OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=rplD PE=3 SV=1 | 69 | 240 | 8.0E-15 |
sp|B4U745|RL4_HYDS0 | 50S ribosomal protein L4 OS=Hydrogenobaculum sp. (strain Y04AAS1) GN=rplD PE=3 SV=1 | 53 | 151 | 8.0E-15 |
sp|B9E9J2|RL4_MACCJ | 50S ribosomal protein L4 OS=Macrococcus caseolyticus (strain JCSC5402) GN=rplD PE=3 SV=1 | 56 | 159 | 8.0E-15 |
sp|C1DKL4|RL4_AZOVD | 50S ribosomal protein L4 OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=rplD PE=3 SV=1 | 56 | 169 | 9.0E-15 |
sp|A7Z0N9|RL4_BACMF | 50S ribosomal protein L4 OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=rplD PE=3 SV=1 | 56 | 201 | 9.0E-15 |
sp|Q9Z9L3|RL4_BACHD | 50S ribosomal protein L4 OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=rplD PE=3 SV=1 | 54 | 201 | 9.0E-15 |
sp|B9DM18|RL4_STACT | 50S ribosomal protein L4 OS=Staphylococcus carnosus (strain TM300) GN=rplD PE=3 SV=1 | 54 | 200 | 9.0E-15 |
sp|Q1GPA0|RL4_SPHAL | 50S ribosomal protein L4 OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=rplD PE=3 SV=1 | 50 | 199 | 1.0E-14 |
sp|A1REB5|RL4_SHESW | 50S ribosomal protein L4 OS=Shewanella sp. (strain W3-18-1) GN=rplD PE=3 SV=1 | 56 | 151 | 1.0E-14 |
sp|A4YBY2|RL4_SHEPC | 50S ribosomal protein L4 OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=rplD PE=3 SV=1 | 56 | 151 | 1.0E-14 |
sp|Q12SV8|RL4_SHEDO | 50S ribosomal protein L4 OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=rplD PE=3 SV=1 | 56 | 151 | 1.0E-14 |
sp|A9KWA3|RL4_SHEB9 | 50S ribosomal protein L4 OS=Shewanella baltica (strain OS195) GN=rplD PE=3 SV=1 | 56 | 151 | 1.0E-14 |
sp|A6WHS9|RL4_SHEB8 | 50S ribosomal protein L4 OS=Shewanella baltica (strain OS185) GN=rplD PE=3 SV=1 | 56 | 151 | 1.0E-14 |
sp|A3DA71|RL4_SHEB5 | 50S ribosomal protein L4 OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=rplD PE=3 SV=1 | 56 | 151 | 1.0E-14 |
sp|B8EBK4|RL4_SHEB2 | 50S ribosomal protein L4 OS=Shewanella baltica (strain OS223) GN=rplD PE=3 SV=1 | 56 | 151 | 1.0E-14 |
sp|Q5WLR1|RL4_BACSK | 50S ribosomal protein L4 OS=Bacillus clausii (strain KSM-K16) GN=rplD PE=3 SV=1 | 56 | 248 | 1.0E-14 |
sp|Q5NQ63|RL4_ZYMMO | 50S ribosomal protein L4 OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=rplD PE=3 SV=1 | 53 | 162 | 1.0E-14 |
sp|C4Z2T1|RL4_EUBE2 | 50S ribosomal protein L4 OS=Eubacterium eligens (strain ATCC 27750 / VPI C15-48) GN=rplD PE=3 SV=1 | 50 | 157 | 1.0E-14 |
sp|Q0I0A4|RL4_SHESR | 50S ribosomal protein L4 OS=Shewanella sp. (strain MR-7) GN=rplD PE=3 SV=1 | 56 | 232 | 1.0E-14 |
sp|Q0HNT6|RL4_SHESM | 50S ribosomal protein L4 OS=Shewanella sp. (strain MR-4) GN=rplD PE=3 SV=1 | 56 | 232 | 1.0E-14 |
sp|A1T0E1|RL4_PSYIN | 50S ribosomal protein L4 OS=Psychromonas ingrahamii (strain 37) GN=rplD PE=3 SV=1 | 56 | 232 | 2.0E-14 |
sp|Q9ZI49|RL4_AQUPY | 50S ribosomal protein L4 OS=Aquifex pyrophilus GN=rplD PE=3 SV=1 | 48 | 245 | 2.0E-14 |
sp|O06114|RL4_MYCSM | 50S ribosomal protein L4 OS=Mycobacterium smegmatis GN=rplD PE=3 SV=1 | 56 | 160 | 2.0E-14 |
sp|A6LLL4|RL4_THEM4 | 50S ribosomal protein L4 OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=rplD PE=3 SV=1 | 54 | 159 | 2.0E-14 |
sp|A4IZT3|RL4_FRATW | 50S ribosomal protein L4 OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=rplD PE=3 SV=1 | 56 | 152 | 2.0E-14 |
sp|Q5NHW7|RL4_FRATT | 50S ribosomal protein L4 OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=rplD PE=3 SV=1 | 56 | 152 | 2.0E-14 |
sp|Q0BNS6|RL4_FRATO | 50S ribosomal protein L4 OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=rplD PE=3 SV=1 | 56 | 152 | 2.0E-14 |
sp|A0Q4I4|RL4_FRATN | 50S ribosomal protein L4 OS=Francisella tularensis subsp. novicida (strain U112) GN=rplD PE=3 SV=1 | 56 | 152 | 2.0E-14 |
sp|Q2A5G9|RL4_FRATH | 50S ribosomal protein L4 OS=Francisella tularensis subsp. holarctica (strain LVS) GN=rplD PE=3 SV=1 | 56 | 152 | 2.0E-14 |
sp|A7N9S7|RL4_FRATF | 50S ribosomal protein L4 OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=rplD PE=3 SV=1 | 56 | 152 | 2.0E-14 |
sp|Q14JB9|RL4_FRAT1 | 50S ribosomal protein L4 OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=rplD PE=3 SV=1 | 56 | 152 | 2.0E-14 |
sp|B3QY25|RL4_CHLT3 | 50S ribosomal protein L4 OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) GN=rplD PE=3 SV=1 | 35 | 152 | 2.0E-14 |
sp|A0PM64|RL4_MYCUA | 50S ribosomal protein L4 OS=Mycobacterium ulcerans (strain Agy99) GN=rplD PE=3 SV=1 | 48 | 147 | 2.0E-14 |
sp|B2HSN2|RL4_MYCMM | 50S ribosomal protein L4 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=rplD PE=3 SV=1 | 48 | 147 | 2.0E-14 |
sp|A0KRM5|RL4_SHESA | 50S ribosomal protein L4 OS=Shewanella sp. (strain ANA-3) GN=rplD PE=3 SV=1 | 56 | 151 | 2.0E-14 |
sp|Q8EK67|RL4_SHEON | 50S ribosomal protein L4 OS=Shewanella oneidensis (strain MR-1) GN=rplD PE=3 SV=1 | 56 | 151 | 2.0E-14 |
sp|Q493K7|RL4_BLOPB | 50S ribosomal protein L4 OS=Blochmannia pennsylvanicus (strain BPEN) GN=rplD PE=3 SV=1 | 44 | 139 | 2.0E-14 |
sp|P49546|RK4_ODOSI | 50S ribosomal protein L4, chloroplastic OS=Odontella sinensis GN=rpl4 PE=3 SV=1 | 56 | 159 | 2.0E-14 |
sp|Q8R7V5|RL4_CALS4 | 50S ribosomal protein L4 OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=rplD PE=3 SV=1 | 50 | 152 | 2.0E-14 |
sp|B8IYH3|RL4_DESDA | 50S ribosomal protein L4 OS=Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949) GN=rplD PE=3 SV=1 | 48 | 151 | 2.0E-14 |
sp|B7IHU7|RL4_THEAB | 50S ribosomal protein L4 OS=Thermosipho africanus (strain TCF52B) GN=rplD PE=3 SV=1 | 55 | 159 | 3.0E-14 |
sp|Q89A69|RL4_BUCBP | 50S ribosomal protein L4 OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=rplD PE=3 SV=1 | 56 | 198 | 3.0E-14 |
sp|Q8D211|RL4_WIGBR | 50S ribosomal protein L4 OS=Wigglesworthia glossinidia brevipalpis GN=rplD PE=3 SV=1 | 67 | 152 | 3.0E-14 |
sp|B2SDY4|RL4_FRATM | 50S ribosomal protein L4 OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=rplD PE=3 SV=1 | 56 | 152 | 3.0E-14 |
sp|Q6F1Z3|RL4_MESFL | 50S ribosomal protein L4 OS=Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1) GN=rplD PE=3 SV=1 | 54 | 200 | 3.0E-14 |
sp|A2CC28|RL4_PROM3 | 50S ribosomal protein L4 OS=Prochlorococcus marinus (strain MIT 9303) GN=rplD PE=3 SV=1 | 55 | 180 | 3.0E-14 |
sp|Q0ID06|RL4_SYNS3 | 50S ribosomal protein L4 OS=Synechococcus sp. (strain CC9311) GN=rplD PE=3 SV=1 | 55 | 152 | 3.0E-14 |
sp|Q089Q3|RL4_SHEFN | 50S ribosomal protein L4 OS=Shewanella frigidimarina (strain NCIMB 400) GN=rplD PE=3 SV=1 | 56 | 232 | 3.0E-14 |
sp|B0K5P4|RL4_THEPX | 50S ribosomal protein L4 OS=Thermoanaerobacter sp. (strain X514) GN=rplD PE=3 SV=1 | 50 | 159 | 3.0E-14 |
sp|B0KCK1|RL4_THEP3 | 50S ribosomal protein L4 OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=rplD PE=3 SV=1 | 50 | 159 | 3.0E-14 |
sp|Q1IX73|RL4_DEIGD | 50S ribosomal protein L4 OS=Deinococcus geothermalis (strain DSM 11300) GN=rplD PE=3 SV=1 | 56 | 171 | 4.0E-14 |
sp|Q0ABH4|RL4_ALKEH | 50S ribosomal protein L4 OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=rplD PE=3 SV=1 | 52 | 174 | 4.0E-14 |
sp|Q2JIM6|RL4_SYNJB | 50S ribosomal protein L4 OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=rplD PE=3 SV=1 | 56 | 261 | 4.0E-14 |
sp|P42921|RL4_BACSU | 50S ribosomal protein L4 OS=Bacillus subtilis (strain 168) GN=rplD PE=1 SV=1 | 56 | 248 | 4.0E-14 |
sp|A0QSD2|RL4_MYCS2 | 50S ribosomal protein L4 OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=rplD PE=1 SV=1 | 56 | 160 | 4.0E-14 |
sp|Q3APH4|RL4_CHLCH | 50S ribosomal protein L4 OS=Chlorobium chlorochromatii (strain CaD3) GN=rplD PE=3 SV=1 | 67 | 161 | 4.0E-14 |
sp|P10135|RL4_MYCCT | 50S ribosomal protein L4 OS=Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154) GN=rplD PE=3 SV=2 | 57 | 160 | 4.0E-14 |
sp|Q8KAH3|RL4_CHLTE | 50S ribosomal protein L4 OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=rplD PE=3 SV=1 | 67 | 161 | 4.0E-14 |
sp|Q28UW1|RL4_JANSC | 50S ribosomal protein L4 OS=Jannaschia sp. (strain CCS1) GN=rplD PE=3 SV=1 | 50 | 162 | 5.0E-14 |
sp|Q1AU30|RL4_RUBXD | 50S ribosomal protein L4 OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=rplD PE=3 SV=1 | 56 | 244 | 5.0E-14 |
sp|C4ZBD5|RL4_EUBR3 | 50S ribosomal protein L4 OS=Eubacterium rectale (strain ATCC 33656 / VPI 0990) GN=rplD PE=3 SV=1 | 50 | 157 | 5.0E-14 |
sp|P61066|RL4_MYCPA | 50S ribosomal protein L4 OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=rplD PE=3 SV=1 | 51 | 160 | 5.0E-14 |
sp|A0QL17|RL4_MYCA1 | 50S ribosomal protein L4 OS=Mycobacterium avium (strain 104) GN=rplD PE=3 SV=1 | 51 | 160 | 5.0E-14 |
sp|B8D0C5|RL4_HALOH | 50S ribosomal protein L4 OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=rplD PE=3 SV=1 | 56 | 246 | 5.0E-14 |
sp|Q2JV82|RL4_SYNJA | 50S ribosomal protein L4 OS=Synechococcus sp. (strain JA-3-3Ab) GN=rplD PE=3 SV=1 | 56 | 155 | 5.0E-14 |
sp|Q2S3R3|RL4_SALRD | 50S ribosomal protein L4 OS=Salinibacter ruber (strain DSM 13855 / M31) GN=rplD PE=3 SV=1 | 68 | 152 | 6.0E-14 |
sp|C4LL51|RL4_CORK4 | 50S ribosomal protein L4 OS=Corynebacterium kroppenstedtii (strain DSM 44385 / CCUG 35717) GN=rplD PE=3 SV=1 | 56 | 160 | 6.0E-14 |
sp|A5WCJ1|RL4_PSYWF | 50S ribosomal protein L4 OS=Psychrobacter sp. (strain PRwf-1) GN=rplD PE=3 SV=1 | 69 | 173 | 6.0E-14 |
sp|Q38UR3|RL4_LACSS | 50S ribosomal protein L4 OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=rplD PE=3 SV=1 | 55 | 159 | 6.0E-14 |
sp|Q839G3|RL4_ENTFA | 50S ribosomal protein L4 OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=rplD PE=3 SV=1 | 56 | 159 | 6.0E-14 |
sp|Q3J8R5|RL4_NITOC | 50S ribosomal protein L4 OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=rplD PE=3 SV=1 | 45 | 147 | 6.0E-14 |
sp|Q2N9B2|RL4_ERYLH | 50S ribosomal protein L4 OS=Erythrobacter litoralis (strain HTCC2594) GN=rplD PE=3 SV=1 | 53 | 174 | 7.0E-14 |
sp|Q7V9W3|RL4_PROMA | 50S ribosomal protein L4 OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=rplD PE=3 SV=1 | 55 | 180 | 7.0E-14 |
sp|Q04G84|RL4_OENOB | 50S ribosomal protein L4 OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=rplD PE=3 SV=1 | 60 | 248 | 7.0E-14 |
sp|Q4L8B3|RL4_STAHJ | 50S ribosomal protein L4 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=rplD PE=3 SV=1 | 56 | 159 | 8.0E-14 |
sp|C4XLX4|RL4_DESMR | 50S ribosomal protein L4 OS=Desulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1) GN=rplD PE=3 SV=1 | 55 | 156 | 9.0E-14 |
sp|Q487Z4|RL4_COLP3 | 50S ribosomal protein L4 OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=rplD PE=3 SV=1 | 56 | 152 | 1.0E-13 |
sp|Q4A5C2|RL4_MYCS5 | 50S ribosomal protein L4 OS=Mycoplasma synoviae (strain 53) GN=rplD PE=3 SV=2 | 57 | 155 | 1.0E-13 |
sp|B0SSH6|RL4_LEPBP | 50S ribosomal protein L4 OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris) GN=rplD PE=3 SV=1 | 57 | 252 | 1.0E-13 |
sp|B0SAF3|RL4_LEPBA | 50S ribosomal protein L4 OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames) GN=rplD PE=3 SV=1 | 57 | 252 | 1.0E-13 |
sp|Q46IR0|RL4_PROMT | 50S ribosomal protein L4 OS=Prochlorococcus marinus (strain NATL2A) GN=rplD PE=3 SV=1 | 55 | 167 | 1.0E-13 |
sp|A4XZ89|RL4_PSEMY | 50S ribosomal protein L4 OS=Pseudomonas mendocina (strain ymp) GN=rplD PE=3 SV=1 | 56 | 152 | 1.0E-13 |
sp|Q2W2J2|RL4_MAGSA | 50S ribosomal protein L4 OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=rplD PE=3 SV=1 | 38 | 150 | 1.0E-13 |
sp|Q890P0|RL4_CLOTE | 50S ribosomal protein L4 OS=Clostridium tetani (strain Massachusetts / E88) GN=rplD PE=3 SV=1 | 44 | 159 | 1.0E-13 |
sp|B0RZU1|RL4_FINM2 | 50S ribosomal protein L4 OS=Finegoldia magna (strain ATCC 29328) GN=rplD PE=3 SV=1 | 56 | 160 | 1.0E-13 |
sp|B8DN97|RL4_DESVM | 50S ribosomal protein L4 OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=rplD PE=3 SV=1 | 69 | 156 | 1.0E-13 |
sp|A5GAW6|RL4_GEOUR | 50S ribosomal protein L4 OS=Geobacter uraniireducens (strain Rf4) GN=rplD PE=3 SV=1 | 56 | 165 | 1.0E-13 |
sp|A7IFY2|RL4_XANP2 | 50S ribosomal protein L4 OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=rplD PE=3 SV=1 | 25 | 171 | 1.0E-13 |
sp|Q8CRG1|RL4_STAES | 50S ribosomal protein L4 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=rplD PE=3 SV=1 | 56 | 159 | 2.0E-13 |
sp|Q5HM00|RL4_STAEQ | 50S ribosomal protein L4 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=rplD PE=3 SV=1 | 56 | 159 | 2.0E-13 |
sp|Q9RXK1|RL4_DEIRA | 50S ribosomal protein L4 OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=rplD PE=1 SV=3 | 45 | 245 | 2.0E-13 |
sp|A0T0H9|RK4_PHATC | 50S ribosomal protein L4, chloroplastic OS=Phaeodactylum tricornutum (strain CCAP 1055/1) GN=rpl4 PE=3 SV=1 | 27 | 149 | 2.0E-13 |
sp|A4SCR0|RL4_CHLPM | 50S ribosomal protein L4 OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=rplD PE=3 SV=1 | 67 | 152 | 2.0E-13 |
sp|P61063|RL4_GEOSL | 50S ribosomal protein L4 OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=rplD PE=3 SV=1 | 28 | 161 | 2.0E-13 |
sp|P61065|RL4_MYCMS | 50S ribosomal protein L4 OS=Mycoplasma mycoides subsp. mycoides SC (strain PG1) GN=rplD PE=3 SV=1 | 57 | 160 | 2.0E-13 |
sp|Q2IXQ9|RL4_RHOP2 | 50S ribosomal protein L4 OS=Rhodopseudomonas palustris (strain HaA2) GN=rplD PE=3 SV=1 | 25 | 245 | 2.0E-13 |
sp|Q250N1|RL4_DESHY | 50S ribosomal protein L4 OS=Desulfitobacterium hafniense (strain Y51) GN=rplD PE=3 SV=1 | 56 | 152 | 2.0E-13 |
sp|B8ELG2|RL4_METSB | 50S ribosomal protein L4 OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=rplD PE=3 SV=1 | 53 | 245 | 2.0E-13 |
sp|Q47LJ4|RL4_THEFY | 50S ribosomal protein L4 OS=Thermobifida fusca (strain YX) GN=rplD PE=3 SV=1 | 46 | 152 | 2.0E-13 |
sp|B8G1W7|RL4_DESHD | 50S ribosomal protein L4 OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=rplD PE=3 SV=1 | 56 | 152 | 2.0E-13 |
sp|Q1GK36|RL4_RUEST | 50S ribosomal protein L4 OS=Ruegeria sp. (strain TM1040) GN=rplD PE=3 SV=1 | 53 | 152 | 2.0E-13 |
sp|A8F4R2|RL4_PSELT | 50S ribosomal protein L4 OS=Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) GN=rplD PE=3 SV=1 | 36 | 157 | 2.0E-13 |
sp|Q3AUW2|RL4_SYNS9 | 50S ribosomal protein L4 OS=Synechococcus sp. (strain CC9902) GN=rplD PE=3 SV=1 | 55 | 159 | 2.0E-13 |
sp|Q3AMN1|RL4_SYNSC | 50S ribosomal protein L4 OS=Synechococcus sp. (strain CC9605) GN=rplD PE=3 SV=1 | 55 | 159 | 2.0E-13 |
sp|Q7VQE7|RL4_BLOFL | 50S ribosomal protein L4 OS=Blochmannia floridanus GN=rplD PE=3 SV=1 | 69 | 152 | 2.0E-13 |
sp|A9W4Q2|RL4_METEP | 50S ribosomal protein L4 OS=Methylobacterium extorquens (strain PA1) GN=rplD PE=3 SV=1 | 53 | 152 | 2.0E-13 |
sp|B7L0R2|RL4_METC4 | 50S ribosomal protein L4 OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=rplD PE=3 SV=1 | 53 | 152 | 2.0E-13 |
sp|B5ELY0|RL4_ACIF5 | 50S ribosomal protein L4 OS=Acidithiobacillus ferrooxidans (strain ATCC 53993) GN=rplD PE=3 SV=1 | 48 | 241 | 2.0E-13 |
sp|B7J468|RL4_ACIF2 | 50S ribosomal protein L4 OS=Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455) GN=rplD PE=3 SV=1 | 48 | 241 | 2.0E-13 |
sp|A1ALU2|RL4_PELPD | 50S ribosomal protein L4 OS=Pelobacter propionicus (strain DSM 2379) GN=rplD PE=3 SV=1 | 48 | 156 | 2.0E-13 |
sp|A0PXU7|RL4_CLONN | 50S ribosomal protein L4 OS=Clostridium novyi (strain NT) GN=rplD PE=3 SV=1 | 50 | 159 | 2.0E-13 |
sp|Q7UZU8|RL4_PROMP | 50S ribosomal protein L4 OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=rplD PE=3 SV=1 | 55 | 172 | 2.0E-13 |
sp|B0U0Y8|RL4_FRAP2 | 50S ribosomal protein L4 OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=rplD PE=3 SV=1 | 56 | 151 | 3.0E-13 |
sp|Q9CDW3|RL4_LACLA | 50S ribosomal protein L4 OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=rplD PE=3 SV=1 | 56 | 159 | 3.0E-13 |
sp|B5YG46|RL4_THEYD | 50S ribosomal protein L4 OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=rplD PE=3 SV=1 | 56 | 152 | 3.0E-13 |
sp|Q3B6G0|RL4_CHLL7 | 50S ribosomal protein L4 OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=rplD PE=3 SV=1 | 67 | 152 | 3.0E-13 |
sp|Q21RV9|RL4_RHOFT | 50S ribosomal protein L4 OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=rplD PE=3 SV=1 | 55 | 248 | 3.0E-13 |
sp|Q1WS91|RL4_LACS1 | 50S ribosomal protein L4 OS=Lactobacillus salivarius (strain UCC118) GN=rplD PE=3 SV=1 | 55 | 159 | 3.0E-13 |
sp|B1ZLK5|RL4_METPB | 50S ribosomal protein L4 OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=rplD PE=3 SV=1 | 53 | 152 | 3.0E-13 |
sp|Q6B8V4|RK4_GRATL | 50S ribosomal protein L4, chloroplastic OS=Gracilaria tenuistipitata var. liui GN=rpl4 PE=3 SV=1 | 56 | 143 | 3.0E-13 |
sp|Q6F7R3|RL4_ACIAD | 50S ribosomal protein L4 OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=rplD PE=3 SV=1 | 69 | 152 | 3.0E-13 |
sp|Q02W25|RL4_LACLS | 50S ribosomal protein L4 OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=rplD PE=3 SV=1 | 56 | 159 | 3.0E-13 |
sp|B7GND9|RL4_BIFLS | 50S ribosomal protein L4 OS=Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12) GN=rplD PE=3 SV=1 | 49 | 154 | 3.0E-13 |
sp|Q8G416|RL4_BIFLO | 50S ribosomal protein L4 OS=Bifidobacterium longum (strain NCC 2705) GN=rplD PE=3 SV=1 | 49 | 154 | 3.0E-13 |
sp|B3DQ14|RL4_BIFLD | 50S ribosomal protein L4 OS=Bifidobacterium longum (strain DJO10A) GN=rplD PE=3 SV=1 | 49 | 154 | 3.0E-13 |
sp|A2RNQ4|RL4_LACLM | 50S ribosomal protein L4 OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=rplD PE=3 SV=1 | 56 | 159 | 3.0E-13 |
sp|A0T0X3|RK4_THAPS | 50S ribosomal protein L4, chloroplastic OS=Thalassiosira pseudonana GN=rpl4 PE=3 SV=1 | 56 | 156 | 3.0E-13 |
sp|Q31IY1|RL4_THICR | 50S ribosomal protein L4 OS=Thiomicrospira crunogena (strain XCL-2) GN=rplD PE=3 SV=1 | 69 | 198 | 3.0E-13 |
sp|A2BYT5|RL4_PROM5 | 50S ribosomal protein L4 OS=Prochlorococcus marinus (strain MIT 9515) GN=rplD PE=3 SV=1 | 55 | 141 | 4.0E-13 |
sp|P61055|RL4_LISMO | 50S ribosomal protein L4 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=rplD PE=3 SV=1 | 56 | 202 | 4.0E-13 |
sp|B8DB09|RL4_LISMH | 50S ribosomal protein L4 OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=rplD PE=3 SV=1 | 56 | 202 | 4.0E-13 |
sp|Q71WE7|RL4_LISMF | 50S ribosomal protein L4 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=rplD PE=3 SV=1 | 56 | 202 | 4.0E-13 |
sp|C1KZH9|RL4_LISMC | 50S ribosomal protein L4 OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=rplD PE=3 SV=1 | 56 | 202 | 4.0E-13 |
sp|P61054|RL4_LISIN | 50S ribosomal protein L4 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=rplD PE=3 SV=1 | 56 | 202 | 4.0E-13 |
sp|Q89J85|RL4_BRADU | 50S ribosomal protein L4 OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=rplD PE=3 SV=2 | 53 | 245 | 4.0E-13 |
sp|A1W2Q8|RL4_ACISJ | 50S ribosomal protein L4 OS=Acidovorax sp. (strain JS42) GN=rplD PE=3 SV=1 | 55 | 159 | 4.0E-13 |
sp|B9MB74|RL4_ACIET | 50S ribosomal protein L4 OS=Acidovorax ebreus (strain TPSY) GN=rplD PE=3 SV=1 | 55 | 159 | 4.0E-13 |
sp|Q134T0|RL4_RHOPS | 50S ribosomal protein L4 OS=Rhodopseudomonas palustris (strain BisB5) GN=rplD PE=3 SV=1 | 25 | 245 | 4.0E-13 |
sp|A4YSJ3|RL4_BRASO | 50S ribosomal protein L4 OS=Bradyrhizobium sp. (strain ORS278) GN=rplD PE=3 SV=1 | 53 | 245 | 4.0E-13 |
sp|A5GIU4|RL4_SYNPW | 50S ribosomal protein L4 OS=Synechococcus sp. (strain WH7803) GN=rplD PE=3 SV=1 | 55 | 159 | 5.0E-13 |
sp|Q7U4J9|RL4_SYNPX | 50S ribosomal protein L4 OS=Synechococcus sp. (strain WH8102) GN=rplD PE=3 SV=1 | 55 | 159 | 5.0E-13 |
sp|A8G761|RL4_PROM2 | 50S ribosomal protein L4 OS=Prochlorococcus marinus (strain MIT 9215) GN=rplD PE=3 SV=1 | 55 | 141 | 6.0E-13 |
sp|Q318I5|RL4_PROM9 | 50S ribosomal protein L4 OS=Prochlorococcus marinus (strain MIT 9312) GN=rplD PE=3 SV=1 | 55 | 141 | 6.0E-13 |
sp|B1LWS7|RL4_METRJ | 50S ribosomal protein L4 OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=rplD PE=3 SV=1 | 53 | 152 | 6.0E-13 |
sp|A0ALW7|RL4_LISW6 | 50S ribosomal protein L4 OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=rplD PE=3 SV=1 | 56 | 159 | 6.0E-13 |
sp|A2BTD6|RL4_PROMS | 50S ribosomal protein L4 OS=Prochlorococcus marinus (strain AS9601) GN=rplD PE=3 SV=1 | 55 | 141 | 6.0E-13 |
sp|A5ELM6|RL4_BRASB | 50S ribosomal protein L4 OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=rplD PE=3 SV=1 | 53 | 245 | 7.0E-13 |
sp|Q605B3|RL4_METCA | 50S ribosomal protein L4 OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=rplD PE=3 SV=1 | 67 | 154 | 7.0E-13 |
sp|A8LM49|RL4_DINSH | 50S ribosomal protein L4 OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=rplD PE=3 SV=1 | 53 | 150 | 7.0E-13 |
sp|A3PF46|RL4_PROM0 | 50S ribosomal protein L4 OS=Prochlorococcus marinus (strain MIT 9301) GN=rplD PE=3 SV=1 | 55 | 141 | 7.0E-13 |
sp|Q2GED8|RL4_NEOSM | 50S ribosomal protein L4 OS=Neorickettsia sennetsu (strain Miyayama) GN=rplD PE=3 SV=1 | 48 | 152 | 7.0E-13 |
sp|Q5Z1W2|RL4_NOCFA | 50S ribosomal protein L4 OS=Nocardia farcinica (strain IFM 10152) GN=rplD PE=3 SV=1 | 56 | 160 | 8.0E-13 |
sp|Q4JT48|RL4_CORJK | 50S ribosomal protein L4 OS=Corynebacterium jeikeium (strain K411) GN=rplD PE=3 SV=1 | 56 | 160 | 9.0E-13 |
sp|P47398|RL4_MYCGE | 50S ribosomal protein L4 OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=rplD PE=3 SV=1 | 49 | 248 | 1.0E-12 |
sp|B0V6W9|RL4_ACIBY | 50S ribosomal protein L4 OS=Acinetobacter baumannii (strain AYE) GN=rplD PE=3 SV=1 | 69 | 152 | 1.0E-12 |
sp|A3M982|RL4_ACIBT | 50S ribosomal protein L4 OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=rplD PE=3 SV=1 | 69 | 152 | 1.0E-12 |
sp|B0VQR9|RL4_ACIBS | 50S ribosomal protein L4 OS=Acinetobacter baumannii (strain SDF) GN=rplD PE=3 SV=1 | 69 | 152 | 1.0E-12 |
sp|B2HZM1|RL4_ACIBC | 50S ribosomal protein L4 OS=Acinetobacter baumannii (strain ACICU) GN=rplD PE=3 SV=1 | 69 | 152 | 1.0E-12 |
sp|B7IA38|RL4_ACIB5 | 50S ribosomal protein L4 OS=Acinetobacter baumannii (strain AB0057) GN=rplD PE=3 SV=1 | 69 | 152 | 1.0E-12 |
sp|B7GW03|RL4_ACIB3 | 50S ribosomal protein L4 OS=Acinetobacter baumannii (strain AB307-0294) GN=rplD PE=3 SV=1 | 69 | 152 | 1.0E-12 |
sp|Q9L0D9|RL4_STRCO | 50S ribosomal protein L4 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=rplD PE=3 SV=1 | 41 | 160 | 1.0E-12 |
sp|Q5LLU7|RL4_RUEPO | 50S ribosomal protein L4 OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=rplD PE=3 SV=1 | 53 | 152 | 1.0E-12 |
sp|O80361|RK4_TOBAC | 50S ribosomal protein L4, chloroplastic OS=Nicotiana tabacum GN=RPL4 PE=2 SV=1 | 24 | 252 | 1.0E-12 |
sp|A1S219|RL4_SHEAM | 50S ribosomal protein L4 OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=rplD PE=3 SV=1 | 56 | 151 | 1.0E-12 |
sp|Q16AF3|RL4_ROSDO | 50S ribosomal protein L4 OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=rplD PE=3 SV=1 | 53 | 152 | 1.0E-12 |
sp|Q3SSW5|RL4_NITWN | 50S ribosomal protein L4 OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=rplD PE=3 SV=1 | 42 | 245 | 1.0E-12 |
sp|Q07KL9|RL4_RHOP5 | 50S ribosomal protein L4 OS=Rhodopseudomonas palustris (strain BisA53) GN=rplD PE=3 SV=1 | 44 | 245 | 2.0E-12 |
sp|C1F641|RL4_ACIC5 | 50S ribosomal protein L4 OS=Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161) GN=rplD PE=3 SV=1 | 56 | 151 | 2.0E-12 |
sp|B1XSQ2|RL4_POLNS | 50S ribosomal protein L4 OS=Polynucleobacter necessarius subsp. necessarius (strain STIR1) GN=rplD PE=3 SV=1 | 61 | 159 | 2.0E-12 |
sp|P38516|RL4_THEMA | 50S ribosomal protein L4 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=rplD PE=1 SV=2 | 55 | 143 | 2.0E-12 |
sp|B3E7T6|RL4_GEOLS | 50S ribosomal protein L4 OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=rplD PE=3 SV=1 | 46 | 246 | 2.0E-12 |
sp|Q30TW3|RL4_SULDN | 50S ribosomal protein L4 OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=rplD PE=3 SV=1 | 57 | 150 | 2.0E-12 |
sp|O32982|RL4_MYCLE | 50S ribosomal protein L4 OS=Mycobacterium leprae (strain TN) GN=rplD PE=3 SV=1 | 51 | 147 | 3.0E-12 |
sp|B8ZSB8|RL4_MYCLB | 50S ribosomal protein L4 OS=Mycobacterium leprae (strain Br4923) GN=rplD PE=3 SV=1 | 51 | 147 | 3.0E-12 |
sp|Q9TLT3|RK4_CYACA | 50S ribosomal protein L4, chloroplastic OS=Cyanidium caldarium GN=rpl4 PE=3 SV=1 | 56 | 154 | 3.0E-12 |
sp|B9JVN8|RL4_AGRVS | 50S ribosomal protein L4 OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=rplD PE=3 SV=1 | 53 | 150 | 3.0E-12 |
sp|Q1QN29|RL4_NITHX | 50S ribosomal protein L4 OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=rplD PE=3 SV=1 | 53 | 245 | 3.0E-12 |
sp|Q6A6M7|RL4_PROAC | 50S ribosomal protein L4 OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=rplD PE=3 SV=1 | 56 | 160 | 3.0E-12 |
sp|Q88XY5|RL4_LACPL | 50S ribosomal protein L4 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=rplD PE=3 SV=1 | 55 | 228 | 3.0E-12 |
sp|Q8NT08|RL4_CORGL | 50S ribosomal protein L4 OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=rplD PE=3 SV=1 | 56 | 160 | 4.0E-12 |
sp|A4QBI0|RL4_CORGB | 50S ribosomal protein L4 OS=Corynebacterium glutamicum (strain R) GN=rplD PE=3 SV=1 | 56 | 160 | 4.0E-12 |
sp|A6LPR2|RL4_CLOB8 | 50S ribosomal protein L4 OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=rplD PE=3 SV=1 | 67 | 245 | 4.0E-12 |
sp|P61069|RL4_SPIKU | 50S ribosomal protein L4 OS=Spiroplasma kunkelii GN=rplD PE=3 SV=1 | 57 | 246 | 4.0E-12 |
sp|Q03EB7|RL4_PEDPA | 50S ribosomal protein L4 OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=rplD PE=3 SV=1 | 55 | 159 | 4.0E-12 |
sp|P75579|RL4_MYCPN | 50S ribosomal protein L4 OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=rplD PE=3 SV=1 | 31 | 248 | 4.0E-12 |
sp|C5CP52|RL4_VARPS | 50S ribosomal protein L4 OS=Variovorax paradoxus (strain S110) GN=rplD PE=3 SV=1 | 55 | 159 | 4.0E-12 |
sp|Q82DP4|RL4_STRAW | 50S ribosomal protein L4 OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=rplD PE=3 SV=1 | 41 | 160 | 5.0E-12 |
sp|B6JET4|RL4_OLICO | 50S ribosomal protein L4 OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=rplD PE=3 SV=1 | 53 | 245 | 6.0E-12 |
GO Term | Description | Terminal node |
---|---|---|
GO:0003735 | structural constituent of ribosome | Yes |
GO:0005840 | ribosome | Yes |
GO:0006412 | translation | Yes |
GO:0008152 | metabolic process | No |
GO:0043228 | non-membrane-bounded organelle | No |
GO:0043603 | cellular amide metabolic process | No |
GO:0043229 | intracellular organelle | No |
GO:0009059 | macromolecule biosynthetic process | No |
GO:1901576 | organic substance biosynthetic process | No |
GO:0005198 | structural molecule activity | No |
GO:0009058 | biosynthetic process | No |
GO:0009987 | cellular process | No |
GO:0008150 | biological_process | No |
GO:1901566 | organonitrogen compound biosynthetic process | No |
GO:0044238 | primary metabolic process | No |
GO:0043226 | organelle | No |
GO:0019538 | protein metabolic process | No |
GO:0034645 | cellular macromolecule biosynthetic process | No |
GO:0034641 | cellular nitrogen compound metabolic process | No |
GO:0005575 | cellular_component | No |
GO:0043170 | macromolecule metabolic process | No |
GO:0006807 | nitrogen compound metabolic process | No |
GO:0006518 | peptide metabolic process | No |
GO:0071704 | organic substance metabolic process | No |
GO:0043604 | amide biosynthetic process | No |
GO:0044271 | cellular nitrogen compound biosynthetic process | No |
GO:0044249 | cellular biosynthetic process | No |
GO:0043232 | intracellular non-membrane-bounded organelle | No |
GO:0003674 | molecular_function | No |
GO:0110165 | cellular anatomical entity | No |
GO:0044260 | cellular macromolecule metabolic process | No |
GO:1901564 | organonitrogen compound metabolic process | No |
GO:0044237 | cellular metabolic process | No |
GO:0043043 | peptide biosynthetic process | No |
SignalP signal predicted | Location (based on Ymax) |
D score (significance: > 0.45) |
---|---|---|
No | 1 - 25 | 0.45 |
Type of sequence | Sequence |
---|---|
Locus | Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
Protein | >OphauG2|3906 MRTMATAPTGSAQSLLQSWYPTTTVPLTIHSFPSLEPVSLEHWSTQHLHLPLRRDLLYRAICYEGDSHRQGSASS KTRYQVAGSHTKIRPQKGSGLARAGTRQSPIFRGGGKPFGPHPRDFSTRLNKKIYDQAWRTALSYRYRRGELIVC QDGMDFDFPSMLHHIPKRGINKPIHDAYIRKYMTGILKELQLTGRTLFITAGRRRGNLHQGMLLAPRLGRVLDLA DVDVKDLLETRKVVMERSVLRDMISQHQSDLVSNIVIHGAAHKGPPLGVEMLPKQ* |
Coding | >OphauG2|3906 ATGCGCACCATGGCCACGGCGCCAACTGGCAGCGCTCAATCTCTCCTCCAGTCCTGGTACCCAACCACCACGGTC CCCCTCACCATCCACAGCTTCCCATCCCTCGAGCCCGTCTCTCTCGAACACTGGTCCACCCAACACCTCCACCTC CCTCTCCGCCGCGACCTCCTCTACCGCGCAATCTGCTACGAGGGCGACTCGCACCGCCAAGGCTCCGCCAGCTCC AAGACCCGCTACCAAGTCGCCGGCTCCCACACCAAAATCCGGCCCCAAAAGGGCTCCGGCCTCGCCCGCGCCGGC ACCCGCCAGTCCCCCATCTTCCGCGGCGGCGGCAAGCCCTTTGGCCCCCACCCCCGCGACTTTTCCACCCGCCTG AATAAGAAAATCTACGACCAGGCCTGGCGCACCGCCCTCAGCTACAGATACCGCCGCGGTGAGCTCATTGTCTGC CAAGACGGCATGGACTTTGACTTTCCCTCCATGCTGCACCATATCCCCAAACGTGGCATCAATAAACCCATCCAC GATGCTTATATCCGCAAATACATGACGGGCATTCTCAAAGAGCTGCAGCTCACCGGCCGCACCCTCTTCATCACT GCCGGCCGCAGACGAGGCAACTTGCACCAGGGCATGCTGCTCGCCCCGAGACTGGGCCGTGTCTTGGACCTGGCA GACGTTGATGTCAAGGATTTGCTGGAAACGCGCAAGGTGGTCATGGAGCGCAGTGTCTTGCGCGACATGATTTCC CAGCACCAGTCAGACTTGGTCAGCAACATTGTCATTCACGGCGCAGCGCACAAGGGGCCGCCGTTGGGTGTCGAA ATGCTTCCCAAGCAGTAG |
Transcript | >OphauG2|3906 ATGCGCACCATGGCCACGGCGCCAACTGGCAGCGCTCAATCTCTCCTCCAGTCCTGGTACCCAACCACCACGGTC CCCCTCACCATCCACAGCTTCCCATCCCTCGAGCCCGTCTCTCTCGAACACTGGTCCACCCAACACCTCCACCTC CCTCTCCGCCGCGACCTCCTCTACCGCGCAATCTGCTACGAGGGCGACTCGCACCGCCAAGGCTCCGCCAGCTCC AAGACCCGCTACCAAGTCGCCGGCTCCCACACCAAAATCCGGCCCCAAAAGGGCTCCGGCCTCGCCCGCGCCGGC ACCCGCCAGTCCCCCATCTTCCGCGGCGGCGGCAAGCCCTTTGGCCCCCACCCCCGCGACTTTTCCACCCGCCTG AATAAGAAAATCTACGACCAGGCCTGGCGCACCGCCCTCAGCTACAGATACCGCCGCGGTGAGCTCATTGTCTGC CAAGACGGCATGGACTTTGACTTTCCCTCCATGCTGCACCATATCCCCAAACGTGGCATCAATAAACCCATCCAC GATGCTTATATCCGCAAATACATGACGGGCATTCTCAAAGAGCTGCAGCTCACCGGCCGCACCCTCTTCATCACT GCCGGCCGCAGACGAGGCAACTTGCACCAGGGCATGCTGCTCGCCCCGAGACTGGGCCGTGTCTTGGACCTGGCA GACGTTGATGTCAAGGATTTGCTGGAAACGCGCAAGGTGGTCATGGAGCGCAGTGTCTTGCGCGACATGATTTCC CAGCACCAGTCAGACTTGGTCAGCAACATTGTCATTCACGGCGCAGCGCACAAGGGGCCGCCGTTGGGTGTCGAA ATGCTTCCCAAGCAGTAG |
Gene | >OphauG2|3906 ATGCGCACCATGGCCACGGCGCCAACTGGCAGCGCTCAATCTCTCCTCCAGTCCTGGTACCCAACCACCACGGTC CCCCTCACCATCCACAGCTTCCCATCCCTCGAGCCCGTCTCTCTCGAACACTGGTCCACCCAACACCTCCACCTC CCTCTCCGCCGCGACCTCCTCTACCGCGCAATCTGCTACGAGGGCGACTCGCACCGCCAAGGCTCCGCCAGCTCC AAGACCCGCTACCAAGTCGCCGGCTCCCACACCAAAATCCGGCCCCAAAAGGGCTCCGGCCTCGCCCGCGCCGGC ACCCGCCAGTCCCCCATCTTCCGCGGCGGCGGCAAGCCCTTTGGCCCCCACCCCCGCGACTTTTCCACCCGCCTG AATAAGAAAATCTACGACCAGGCCTGGCGCACCGCCCTCAGCTACAGATACCGCCGCGGTGAGCTCATTGTCTGC CAAGACGGCATGGACTTTGACTTTCCCTCCATGCTGCACCATATCCCCAAACGTGGCATCAATAAACCCATCCAC GATGCTTATATCCGCAAATACATGACGGGCATTCTCAAAGAGCTGCAGCTCACCGGCCGCACCCTCTTCATCACT GCCGGCCGCAGACGAGGCAACTTGCACCAGGGCATGCTGCTCGCCCCGAGACTGGGCCGTGTCTTGGACCTGGCA GACGTTGATGTCAAGGATTTGCTGGAAACGCGCAAGGTGGTCATGGAGCGCAGTGTCTTGCGCGACATGATTTCC CAGCACCAGTCAGACTTGGTCAGCAACATTGTCATTCACGGCGCAGCGCACAAGGGGCCGCCGTTGGGTGTCGAA ATGCTTCCCAAGCAGTAG |