Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|3902
Gene name
LocationContig_306:16258..17967
Strand+
Gene length (bp)1709
Transcript length (bp)1650
Coding sequence length (bp)1650
Protein length (aa) 550

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08598 Sds3 Sds3-like 3.8E-19 39 242

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3859
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3902 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|6517
Ophiocordyceps camponoti-floridani Ophcf2|06608
Ophiocordyceps camponoti-rufipedis Ophun1|3233
Ophiocordyceps kimflemingae Ophio5|5011
Ophiocordyceps subramaniannii Hirsu2|7647

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|3902
MAASDAVSVSVPSTNGRLDGRSPLPPAPSKRDRKRQAVMERLAHLHDKFQSDKDSVYRDQLQRIQYELNSIQNFD
VYAPDAFEKAGELQRDYGRVIGSPYKAENARTIVDMAGKQLPQFLSDIQDLLETRDFQLTRSKDEYDRKALEYKN
THTFKTETAKREHEALNTTMRDRLINQLNVKKSRLTKEREVFEICETNALLLNPAQFSLTNPGSPGGHTGKRSTR
NRREADDGHDSRKRKRNGDEDDGSPAPTRRGLDVNGTTPYWQSEKGRNEVRKQGATYTINNLFTDKELSMNYNTA
ALASHHFMVRHRNNVHSNIPGSPEESDAGNGDSNGAGAAEAANHSAPAMERQVSHATRSTQRATANQNPLEDKLL
GIEGIGTFELPSNLDLMHGTSDSRPIMPSCVPLNSVKSVVRNPEFKTRPLSVEEAGADLQLMKTLQQYDATRKPG
SHLDNPKGFRKTLEAVAVPYTSASYVALKSIPRQNPNVFEESLAGGAVQSNLREQTSPNRRGNLIRNVAPPMSRQ
SSAGGVAMSRQGTAQSNRGKVRKG*
Coding >OphauG2|3902
ATGGCTGCTAGCGACGCCGTCAGTGTCTCGGTCCCGAGCACCAACGGTCGACTCGACGGACGCTCCCCTCTGCCC
CCAGCACCATCTAAGCGTGATCGAAAGCGCCAGGCCGTCATGGAGCGGCTGGCCCACCTGCACGATAAGTTTCAG
AGCGATAAGGACTCTGTCTATCGCGACCAACTACAGCGCATACAGTACGAACTAAATAGCATTCAAAATTTCGAC
GTCTACGCTCCCGATGCCTTTGAAAAGGCCGGCGAGCTCCAGAGGGACTATGGCCGGGTTATCGGCTCTCCCTAC
AAGGCTGAAAATGCTCGCACCATTGTAGACATGGCGGGCAAGCAGCTGCCCCAGTTCCTCTCGGATATACAAGAC
TTGCTCGAGACGCGTGACTTCCAGCTCACGCGCTCCAAGGATGAATATGACCGCAAGGCCCTCGAGTACAAGAAT
ACGCACACATTCAAGACGGAGACGGCCAAGCGAGAACACGAGGCGCTAAACACGACGATGCGTGACCGCCTCATC
AACCAGCTCAATGTCAAGAAGAGCAGATTGACCAAGGAGAGAGAGGTTTTCGAGATATGCGAAACGAATGCCTTG
CTCCTCAATCCCGCTCAATTCAGCTTGACCAATCCGGGCAGCCCGGGCGGTCACACGGGGAAGCGCTCCACTCGC
AATCGAAGGGAAGCCGACGACGGCCATGACTCGAGGAAACGGAAGCGGAATGGCGATGAAGACGATGGATCCCCT
GCCCCAACACGCCGCGGCCTCGACGTCAATGGTACCACACCTTACTGGCAGTCAGAAAAGGGCCGCAATGAGGTG
CGCAAGCAGGGTGCTACCTACACAATCAACAACCTCTTCACGGACAAGGAATTGTCCATGAATTACAACACGGCT
GCCTTGGCCTCACATCACTTCATGGTGCGCCATCGTAACAATGTTCATAGCAACATTCCTGGCTCTCCCGAGGAA
AGTGATGCAGGCAATGGAGACAGCAATGGTGCGGGAGCAGCCGAGGCCGCCAATCACTCGGCACCCGCAATGGAG
CGCCAAGTCTCCCATGCGACGAGGAGCACCCAGCGGGCTACTGCCAACCAGAACCCTCTGGAAGACAAGTTGCTG
GGAATCGAGGGCATTGGCACCTTTGAACTACCCTCCAACCTTGACCTGATGCACGGCACCAGCGACAGCAGACCC
ATTATGCCGTCATGCGTGCCTCTGAATTCGGTCAAGTCGGTGGTTCGAAACCCAGAATTCAAGACGAGGCCGTTG
AGTGTAGAAGAAGCTGGAGCCGACCTGCAGCTAATGAAGACGCTGCAGCAGTATGACGCCACTCGCAAGCCAGGG
AGTCATCTGGATAACCCAAAGGGCTTTCGCAAGACTCTGGAAGCTGTTGCGGTGCCATATACCTCTGCTAGTTAT
GTCGCCCTCAAATCTATTCCTCGCCAAAACCCCAACGTCTTTGAGGAATCGCTTGCTGGTGGCGCTGTACAGAGC
AATCTGCGCGAGCAGACGAGCCCAAATAGGCGAGGCAACTTGATTCGCAACGTCGCTCCGCCCATGAGTAGGCAG
AGCAGTGCCGGAGGGGTGGCAATGAGCCGACAGGGGACTGCGCAGAGCAACCGAGGAAAGGTGCGCAAAGGCTGA
Transcript >OphauG2|3902
ATGGCTGCTAGCGACGCCGTCAGTGTCTCGGTCCCGAGCACCAACGGTCGACTCGACGGACGCTCCCCTCTGCCC
CCAGCACCATCTAAGCGTGATCGAAAGCGCCAGGCCGTCATGGAGCGGCTGGCCCACCTGCACGATAAGTTTCAG
AGCGATAAGGACTCTGTCTATCGCGACCAACTACAGCGCATACAGTACGAACTAAATAGCATTCAAAATTTCGAC
GTCTACGCTCCCGATGCCTTTGAAAAGGCCGGCGAGCTCCAGAGGGACTATGGCCGGGTTATCGGCTCTCCCTAC
AAGGCTGAAAATGCTCGCACCATTGTAGACATGGCGGGCAAGCAGCTGCCCCAGTTCCTCTCGGATATACAAGAC
TTGCTCGAGACGCGTGACTTCCAGCTCACGCGCTCCAAGGATGAATATGACCGCAAGGCCCTCGAGTACAAGAAT
ACGCACACATTCAAGACGGAGACGGCCAAGCGAGAACACGAGGCGCTAAACACGACGATGCGTGACCGCCTCATC
AACCAGCTCAATGTCAAGAAGAGCAGATTGACCAAGGAGAGAGAGGTTTTCGAGATATGCGAAACGAATGCCTTG
CTCCTCAATCCCGCTCAATTCAGCTTGACCAATCCGGGCAGCCCGGGCGGTCACACGGGGAAGCGCTCCACTCGC
AATCGAAGGGAAGCCGACGACGGCCATGACTCGAGGAAACGGAAGCGGAATGGCGATGAAGACGATGGATCCCCT
GCCCCAACACGCCGCGGCCTCGACGTCAATGGTACCACACCTTACTGGCAGTCAGAAAAGGGCCGCAATGAGGTG
CGCAAGCAGGGTGCTACCTACACAATCAACAACCTCTTCACGGACAAGGAATTGTCCATGAATTACAACACGGCT
GCCTTGGCCTCACATCACTTCATGGTGCGCCATCGTAACAATGTTCATAGCAACATTCCTGGCTCTCCCGAGGAA
AGTGATGCAGGCAATGGAGACAGCAATGGTGCGGGAGCAGCCGAGGCCGCCAATCACTCGGCACCCGCAATGGAG
CGCCAAGTCTCCCATGCGACGAGGAGCACCCAGCGGGCTACTGCCAACCAGAACCCTCTGGAAGACAAGTTGCTG
GGAATCGAGGGCATTGGCACCTTTGAACTACCCTCCAACCTTGACCTGATGCACGGCACCAGCGACAGCAGACCC
ATTATGCCGTCATGCGTGCCTCTGAATTCGGTCAAGTCGGTGGTTCGAAACCCAGAATTCAAGACGAGGCCGTTG
AGTGTAGAAGAAGCTGGAGCCGACCTGCAGCTAATGAAGACGCTGCAGCAGTATGACGCCACTCGCAAGCCAGGG
AGTCATCTGGATAACCCAAAGGGCTTTCGCAAGACTCTGGAAGCTGTTGCGGTGCCATATACCTCTGCTAGTTAT
GTCGCCCTCAAATCTATTCCTCGCCAAAACCCCAACGTCTTTGAGGAATCGCTTGCTGGTGGCGCTGTACAGAGC
AATCTGCGCGAGCAGACGAGCCCAAATAGGCGAGGCAACTTGATTCGCAACGTCGCTCCGCCCATGAGTAGGCAG
AGCAGTGCCGGAGGGGTGGCAATGAGCCGACAGGGGACTGCGCAGAGCAACCGAGGAAAGGTGCGCAAAGGCTGA
Gene >OphauG2|3902
ATGGCTGCTAGCGACGCCGTCAGTGTCTCGGTCCCGAGCACCAACGGTCGACTCGACGGACGCTCCCCTCTGCCC
CCAGCACCATCTAAGCGTGATCGAAAGCGCCAGGCCGTCATGGAGCGGCTGGCCCACCTGCACGATAAGTTTCAG
AGCGATAAGGACTCTGTCTATCGCGACCAACTACAGCGCATACAGTACGAACTAAATAGCATTCAAAATTTCGAC
GTCTACGCTCCCGATGCCTTTGAAAAGGCCGGCGAGCTCCAGAGGGACTATGGCCGGGTTATCGGCTCTCCCTAC
AAGGCTGAAAATGCTCGCACCATTGTAGACATGGCGGGCAAGCAGCTGCCCCAGTTCCTCTCGGATATACAAGAC
TTGCTCGAGACGCGTGACTTCCAGCTCACGCGCTCCAAGGTTGGTCACGCCACCCACTTGTGCCTGAGGCCCTCT
GTTTCTAACAAGAGCCGTTACAGGATGAATATGACCGCAAGGCCCTCGAGTACAAGAATACGCACACATTCAAGA
CGGAGACGGCCAAGCGAGAACACGAGGCGCTAAACACGACGATGCGTGACCGCCTCATCAACCAGCTCAATGTCA
AGAAGAGCAGATTGACCAAGGAGAGAGAGGTTTTCGAGATATGCGAAACGAATGCCTTGCTCCTCAATCCCGCTC
AATTCAGCTTGACCAATCCGGGCAGCCCGGGCGGTCACACGGGGAAGCGCTCCACTCGCAATCGAAGGGAAGCCG
ACGACGGCCATGACTCGAGGAAACGGAAGCGGAATGGCGATGAAGACGATGGATCCCCTGCCCCAACACGCCGCG
GCCTCGACGTCAATGGTACCACACCTTACTGGCAGTCAGAAAAGGGCCGCAATGAGGTGCGCAAGCAGGGTGCTA
CCTACACAATCAACAACCTCTTCACGGACAAGGAATTGTCCATGAATTACAACACGGCTGCCTTGGCCTCACATC
ACTTCATGGTGCGCCATCGTAACAATGTTCATAGCAACATTCCTGGCTCTCCCGAGGAAAGTGATGCAGGCAATG
GAGACAGCAATGGTGCGGGAGCAGCCGAGGCCGCCAATCACTCGGCACCCGCAATGGAGCGCCAAGTCTCCCATG
CGACGAGGAGCACCCAGCGGGCTACTGCCAACCAGAACCCTCTGGAAGACAAGTTGCTGGGAATCGAGGGCATTG
GCACCTTTGAACTACCCTCCAACCTTGACCTGATGCACGGCACCAGCGACAGCAGACCCATTATGCCGTCATGCG
TGCCTCTGAATTCGGTCAAGTCGGTGGTTCGAAACCCAGAATTCAAGACGAGGCCGTTGAGTGTAGAAGAAGCTG
GAGCCGACCTGCAGCTAATGAAGACGCTGCAGCAGTATGACGCCACTCGCAAGCCAGGGAGTCATCTGGATAACC
CAAAGGGCTTTCGCAAGACTCTGGAAGCTGTTGCGGTGCCATATACCTCTGCTAGTTATGTCGCCCTCAAATCTA
TTCCTCGCCAAAACCCCAACGTCTTTGAGGAATCGCTTGCTGGTGGCGCTGTACAGAGCAATCTGCGCGAGCAGA
CGAGCCCAAATAGGCGAGGCAACTTGATTCGCAACGTCGCTCCGCCCATGAGTAGGCAGAGCAGTGCCGGAGGGG
TGGCAATGAGCCGACAGGGGACTGCGCAGAGCAACCGAGGAAAGGTGCGCAAAGGCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail