Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|390
Gene name
LocationContig_109:16237..17462
Strand+
Gene length (bp)1225
Transcript length (bp)996
Coding sequence length (bp)996
Protein length (aa) 332

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01239 PPTA Protein prenyltransferase alpha subunit repeat 1.2E-04 50 75
PF01239 PPTA Protein prenyltransferase alpha subunit repeat 8.8E-09 102 131
PF01239 PPTA Protein prenyltransferase alpha subunit repeat 1.6E-06 145 176
PF01239 PPTA Protein prenyltransferase alpha subunit repeat 5.4E-05 188 217
PF01239 PPTA Protein prenyltransferase alpha subunit repeat 2.2E-05 235 263

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q00618|PGTA_YEAST Geranylgeranyl transferase type-2 subunit alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BET4 PE=1 SV=3 4 263 3.0E-49
sp|O93829|PGTA_CANAX Geranylgeranyl transferase type-2 subunit alpha OS=Candida albicans GN=BET4 PE=3 SV=1 4 283 2.0E-42
sp|O94412|PGTA_SCHPO Geranylgeranyl transferase type-2 subunit alpha OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bet4 PE=3 SV=1 4 293 3.0E-40
sp|A5A779|PGTA_PIG Geranylgeranyl transferase type-2 subunit alpha OS=Sus scrofa GN=RABGGTA PE=2 SV=1 18 269 2.0E-36
sp|Q5NVK5|PGTA_PONAB Geranylgeranyl transferase type-2 subunit alpha OS=Pongo abelii GN=RABGGTA PE=2 SV=1 18 269 2.0E-36
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q00618|PGTA_YEAST Geranylgeranyl transferase type-2 subunit alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BET4 PE=1 SV=3 4 263 3.0E-49
sp|O93829|PGTA_CANAX Geranylgeranyl transferase type-2 subunit alpha OS=Candida albicans GN=BET4 PE=3 SV=1 4 283 2.0E-42
sp|O94412|PGTA_SCHPO Geranylgeranyl transferase type-2 subunit alpha OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bet4 PE=3 SV=1 4 293 3.0E-40
sp|A5A779|PGTA_PIG Geranylgeranyl transferase type-2 subunit alpha OS=Sus scrofa GN=RABGGTA PE=2 SV=1 18 269 2.0E-36
sp|Q5NVK5|PGTA_PONAB Geranylgeranyl transferase type-2 subunit alpha OS=Pongo abelii GN=RABGGTA PE=2 SV=1 18 269 2.0E-36
sp|Q92696|PGTA_HUMAN Geranylgeranyl transferase type-2 subunit alpha OS=Homo sapiens GN=RABGGTA PE=1 SV=2 18 269 3.0E-36
sp|Q5EA80|PGTA_BOVIN Geranylgeranyl transferase type-2 subunit alpha OS=Bos taurus GN=RABGGTA PE=2 SV=1 18 269 6.0E-35
sp|Q08602|PGTA_RAT Geranylgeranyl transferase type-2 subunit alpha OS=Rattus norvegicus GN=Rabggta PE=1 SV=1 18 262 3.0E-34
sp|Q9JHK4|PGTA_MOUSE Geranylgeranyl transferase type-2 subunit alpha OS=Mus musculus GN=Rabggta PE=1 SV=1 18 262 2.0E-33
sp|Q55DQ4|PGTA_DICDI Geranylgeranyl transferase type-2 subunit alpha OS=Dictyostelium discoideum GN=rabggta PE=3 SV=2 4 266 6.0E-33
sp|P93227|FNTA_SOLLC Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha OS=Solanum lycopersicum GN=FTA PE=1 SV=1 42 263 3.0E-15
sp|O24304|FNTA_PEA Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha OS=Pisum sativum GN=FTA PE=1 SV=1 42 265 1.0E-12
sp|Q04631|FNTA_RAT Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha OS=Rattus norvegicus GN=Fnta PE=1 SV=1 49 263 3.0E-12
sp|Q61239|FNTA_MOUSE Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha OS=Mus musculus GN=Fnta PE=1 SV=1 49 263 2.0E-11
sp|P49354|FNTA_HUMAN Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha OS=Homo sapiens GN=FNTA PE=1 SV=1 49 263 3.0E-11
sp|P29702|FNTA_BOVIN Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha OS=Bos taurus GN=FNTA PE=2 SV=2 49 263 8.0E-11
sp|P29703|FNTA_YEAST Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAM2 PE=1 SV=1 10 258 1.0E-10
sp|Q7Z6K3|PTAR1_HUMAN Protein prenyltransferase alpha subunit repeat-containing protein 1 OS=Homo sapiens GN=PTAR1 PE=1 SV=2 50 227 1.0E-08
sp|Q54RT9|FNTA_DICDI Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha OS=Dictyostelium discoideum GN=fntA PE=3 SV=1 49 208 8.0E-08
sp|O60052|FNTA_SCHPO Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cwp1 PE=1 SV=1 36 256 1.0E-07
sp|A1L3L1|PTR1B_XENLA Protein prenyltransferase alpha subunit repeat-containing protein 1-B (Fragment) OS=Xenopus laevis GN=ptar1-b PE=2 SV=1 50 254 2.0E-06
sp|Q9LX33|FNTA_ARATH Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha OS=Arabidopsis thaliana GN=FTA PE=1 SV=2 104 208 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0008318 protein prenyltransferase activity Yes
GO:0018342 protein prenylation Yes
GO:0043170 macromolecule metabolic process No
GO:0140096 catalytic activity, acting on a protein No
GO:0019538 protein metabolic process No
GO:0044238 primary metabolic process No
GO:0008150 biological_process No
GO:0097354 prenylation No
GO:0008152 metabolic process No
GO:0016765 transferase activity, transferring alkyl or aryl (other than methyl) groups No
GO:0043412 macromolecule modification No
GO:0009987 cellular process No
GO:0006807 nitrogen compound metabolic process No
GO:0071704 organic substance metabolic process No
GO:0004659 prenyltransferase activity No
GO:0036211 protein modification process No
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:1901564 organonitrogen compound metabolic process No
GO:0044237 cellular metabolic process No
GO:0003824 catalytic activity No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3334
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|390 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|8159
Ophiocordyceps camponoti-floridani Ophcf2|04723
Ophiocordyceps camponoti-rufipedis Ophun1|6608
Ophiocordyceps kimflemingae Ophio5|8458
Ophiocordyceps subramaniannii Hirsu2|6167

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|390
MASHGVARIPQPTLTKHQREQQATKIRAYQALDHQVRTRVSAGHLDAHTFSLTTRLLQLNPEYYTIWNVRRRCLA
SPSSFASSPSSRTIDPSALRLDEPSIRSELAFTIPLLLQHPKCYWIWNHRLWILDQAIKHLPAHQARSIWQDELA
LVSKLLHKDRRNFHAWGYRRHVVSHLESPDLQGHSMVESEFHYTTTMISEDLSNFSAWHNRSQLIPRLLSQRAAD
ATSRKDFLYAELDLVHEALNVGPEDQSLWYYHRYLLSNISGKGDIAPDLSPCHRKAYLEHDMSNIRHLCLDYDGI
DSIYEALIQGTLILCKLKDQPLDSQSKQQPS*
Coding >OphauG2|390
ATGGCCAGCCACGGCGTGGCACGTATCCCCCAGCCCACTCTGACCAAGCATCAACGTGAGCAACAGGCCACCAAG
ATTCGTGCCTACCAAGCCCTCGATCATCAGGTGCGCACCCGTGTCTCGGCCGGCCACTTGGATGCCCACACCTTT
TCCCTCACCACGCGCCTGCTGCAACTCAACCCCGAGTACTATACTATCTGGAACGTCCGCCGCCGCTGTCTCGCA
TCTCCTTCTTCTTTCGCTTCCTCTCCCTCATCACGCACTATCGATCCCTCCGCTTTGCGCTTGGACGAACCTAGC
ATCCGCTCTGAACTGGCATTTACAATCCCTCTGCTCCTCCAGCACCCAAAATGCTATTGGATCTGGAATCATCGT
CTGTGGATCCTTGACCAGGCCATCAAGCACCTGCCTGCCCACCAAGCTCGCTCCATCTGGCAAGACGAGTTGGCC
CTGGTATCAAAGTTGCTGCACAAGGATCGCCGCAATTTTCACGCCTGGGGATACCGCCGCCATGTCGTCTCTCAT
CTCGAGAGCCCCGATCTGCAAGGCCATAGCATGGTCGAAAGCGAATTCCACTATACCACCACCATGATCAGTGAG
GACCTCTCAAACTTTTCAGCCTGGCACAATCGAAGCCAGCTTATCCCTCGACTCCTGAGCCAGCGTGCTGCCGAT
GCTACGTCTCGCAAGGATTTTCTCTATGCCGAGCTTGATCTTGTTCATGAAGCCTTGAATGTCGGTCCTGAAGAC
CAATCCTTGTGGTATTATCACCGCTATCTTCTCTCAAACATTTCAGGCAAGGGCGATATTGCTCCAGACTTGTCT
CCCTGCCATCGCAAGGCGTACCTTGAACATGACATGTCCAATATCCGCCATCTGTGCCTAGATTACGACGGCATT
GACTCGATTTATGAGGCTCTTATACAAGGCACTCTGATTCTCTGCAAACTAAAAGACCAACCTCTTGACAGCCAA
AGCAAACAACAACCCAGCTGA
Transcript >OphauG2|390
ATGGCCAGCCACGGCGTGGCACGTATCCCCCAGCCCACTCTGACCAAGCATCAACGTGAGCAACAGGCCACCAAG
ATTCGTGCCTACCAAGCCCTCGATCATCAGGTGCGCACCCGTGTCTCGGCCGGCCACTTGGATGCCCACACCTTT
TCCCTCACCACGCGCCTGCTGCAACTCAACCCCGAGTACTATACTATCTGGAACGTCCGCCGCCGCTGTCTCGCA
TCTCCTTCTTCTTTCGCTTCCTCTCCCTCATCACGCACTATCGATCCCTCCGCTTTGCGCTTGGACGAACCTAGC
ATCCGCTCTGAACTGGCATTTACAATCCCTCTGCTCCTCCAGCACCCAAAATGCTATTGGATCTGGAATCATCGT
CTGTGGATCCTTGACCAGGCCATCAAGCACCTGCCTGCCCACCAAGCTCGCTCCATCTGGCAAGACGAGTTGGCC
CTGGTATCAAAGTTGCTGCACAAGGATCGCCGCAATTTTCACGCCTGGGGATACCGCCGCCATGTCGTCTCTCAT
CTCGAGAGCCCCGATCTGCAAGGCCATAGCATGGTCGAAAGCGAATTCCACTATACCACCACCATGATCAGTGAG
GACCTCTCAAACTTTTCAGCCTGGCACAATCGAAGCCAGCTTATCCCTCGACTCCTGAGCCAGCGTGCTGCCGAT
GCTACGTCTCGCAAGGATTTTCTCTATGCCGAGCTTGATCTTGTTCATGAAGCCTTGAATGTCGGTCCTGAAGAC
CAATCCTTGTGGTATTATCACCGCTATCTTCTCTCAAACATTTCAGGCAAGGGCGATATTGCTCCAGACTTGTCT
CCCTGCCATCGCAAGGCGTACCTTGAACATGACATGTCCAATATCCGCCATCTGTGCCTAGATTACGACGGCATT
GACTCGATTTATGAGGCTCTTATACAAGGCACTCTGATTCTCTGCAAACTAAAAGACCAACCTCTTGACAGCCAA
AGCAAACAACAACCCAGCTGA
Gene >OphauG2|390
ATGGCCAGCGTAAGTCACGCCCTGCCCGCGCCCGTGGCCAAGTCCTGCTGCTGCTCCAGCCTGCTCCTCGACCCT
GCCACTCCAGCCATCCGTCAACTGATCACTTCATCCTAGCACGGCGTGGCACGTATCCCCCAGCCCACTCTGACC
AAGCATCAACGTGAGCAACAGGCCACCAAGATTCGTGCCTACCAAGCCCTCGATCATCAGGTGCGCACCCGTGTC
TCGGCCGGCCACTTGGATGCCCACACCTTTTCCCTCACCACGCGCCTGCTGCAACTCAACCCCGAGTACTATACT
ATCTGGAACGTCCGCCGCCGCTGTCTCGCATCTCCTTCTTCTTTCGCTTCCTCTCCCTCATCACGCACTATCGAT
CCCTCCGCTTTGCGCTTGGACGAACCTAGCATCCGCTCTGAACTGGCATTTACAATCCCTCTGCTCCTCCAGCAC
CCAAAATGCTATTGGATCTGGAATCATCGTCTGTGGATCCTTGACCAGGCCATCAAGCACCTGCCTGCCCACCAA
GCTCGCTCCATCTGGCAAGACGAGTTGGCCCTGGTATCAAAGTTGCTGCACAAGGATCGCCGCAATTTTCACGCC
TGGGGATACCGCCGCCATGTCGTCTCTCATCTCGAGAGCCCCGATCTGCAAGGCCATAGCATGGTCGAAAGCGAA
TTCCACTATACCACCACCATGATCAGTGAGGACCTCTCAAACTTTTCAGCCTGGCACAATCGAAGCCAGCTTATC
CCTCGACTCCTGAGCCAGCGTGCTGCCGATGCTACGTCTCGCAAGGATTTTCTCTATGCCGGTAAGACGCACACG
GCGCCCAATCTCAATCCGTCTAACCTCTTATGTATCGCAGAGCTTGATCTTGTTCATGAAGCCTTGAATGTCGGT
CCTGAAGACCAATCCTTGTGGTATTATCACCGCTATCTTCTCTCAAACATTTCAGGCAAGGGCGATATTGCTCCA
GACTTGTCTCCCTGCCATCGCAAGGCGTACCTTGAACATGACATGTCCAATATCCGCCATCTGTGCCTAGATTAC
GACGGCATTGACTCGATTTATGAGGCTCTTATACAAGGCACTCTGATTCTCTGCAAACTAAAAGACCAACCTCTT
GACAGCCAAAGCAAACAACAAGTTTTGCAATGGCTAGGCAAGCTGACGGAACTCGACCCCAAGCGCAACGGTCGT
TGGAATGATATCAAAGCCCAGCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail