Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|390
Gene name
LocationContig_109:16237..17462
Strand+
Gene length (bp)1225
Transcript length (bp)996
Coding sequence length (bp)996
Protein length (aa) 332

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01239 PPTA Protein prenyltransferase alpha subunit repeat 1.2E-04 50 75
PF01239 PPTA Protein prenyltransferase alpha subunit repeat 8.8E-09 102 131
PF01239 PPTA Protein prenyltransferase alpha subunit repeat 1.6E-06 145 176
PF01239 PPTA Protein prenyltransferase alpha subunit repeat 5.4E-05 188 217
PF01239 PPTA Protein prenyltransferase alpha subunit repeat 2.2E-05 235 263

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q00618|PGTA_YEAST Geranylgeranyl transferase type-2 subunit alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BET4 PE=1 SV=3 4 263 3.0E-49
sp|O93829|PGTA_CANAX Geranylgeranyl transferase type-2 subunit alpha OS=Candida albicans GN=BET4 PE=3 SV=1 4 283 2.0E-42
sp|O94412|PGTA_SCHPO Geranylgeranyl transferase type-2 subunit alpha OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bet4 PE=3 SV=1 4 293 3.0E-40
sp|A5A779|PGTA_PIG Geranylgeranyl transferase type-2 subunit alpha OS=Sus scrofa GN=RABGGTA PE=2 SV=1 18 269 2.0E-36
sp|Q5NVK5|PGTA_PONAB Geranylgeranyl transferase type-2 subunit alpha OS=Pongo abelii GN=RABGGTA PE=2 SV=1 18 269 2.0E-36
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q00618|PGTA_YEAST Geranylgeranyl transferase type-2 subunit alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BET4 PE=1 SV=3 4 263 3.0E-49
sp|O93829|PGTA_CANAX Geranylgeranyl transferase type-2 subunit alpha OS=Candida albicans GN=BET4 PE=3 SV=1 4 283 2.0E-42
sp|O94412|PGTA_SCHPO Geranylgeranyl transferase type-2 subunit alpha OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bet4 PE=3 SV=1 4 293 3.0E-40
sp|A5A779|PGTA_PIG Geranylgeranyl transferase type-2 subunit alpha OS=Sus scrofa GN=RABGGTA PE=2 SV=1 18 269 2.0E-36
sp|Q5NVK5|PGTA_PONAB Geranylgeranyl transferase type-2 subunit alpha OS=Pongo abelii GN=RABGGTA PE=2 SV=1 18 269 2.0E-36
sp|Q92696|PGTA_HUMAN Geranylgeranyl transferase type-2 subunit alpha OS=Homo sapiens GN=RABGGTA PE=1 SV=2 18 269 3.0E-36
sp|Q5EA80|PGTA_BOVIN Geranylgeranyl transferase type-2 subunit alpha OS=Bos taurus GN=RABGGTA PE=2 SV=1 18 269 6.0E-35
sp|Q08602|PGTA_RAT Geranylgeranyl transferase type-2 subunit alpha OS=Rattus norvegicus GN=Rabggta PE=1 SV=1 18 262 3.0E-34
sp|Q9JHK4|PGTA_MOUSE Geranylgeranyl transferase type-2 subunit alpha OS=Mus musculus GN=Rabggta PE=1 SV=1 18 262 2.0E-33
sp|Q55DQ4|PGTA_DICDI Geranylgeranyl transferase type-2 subunit alpha OS=Dictyostelium discoideum GN=rabggta PE=3 SV=2 4 266 6.0E-33
sp|P93227|FNTA_SOLLC Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha OS=Solanum lycopersicum GN=FTA PE=1 SV=1 42 263 3.0E-15
sp|O24304|FNTA_PEA Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha OS=Pisum sativum GN=FTA PE=1 SV=1 42 265 1.0E-12
sp|Q04631|FNTA_RAT Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha OS=Rattus norvegicus GN=Fnta PE=1 SV=1 49 263 3.0E-12
sp|Q61239|FNTA_MOUSE Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha OS=Mus musculus GN=Fnta PE=1 SV=1 49 263 2.0E-11
sp|P49354|FNTA_HUMAN Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha OS=Homo sapiens GN=FNTA PE=1 SV=1 49 263 3.0E-11
sp|P29702|FNTA_BOVIN Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha OS=Bos taurus GN=FNTA PE=2 SV=2 49 263 8.0E-11
sp|P29703|FNTA_YEAST Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAM2 PE=1 SV=1 10 258 1.0E-10
sp|Q7Z6K3|PTAR1_HUMAN Protein prenyltransferase alpha subunit repeat-containing protein 1 OS=Homo sapiens GN=PTAR1 PE=1 SV=2 50 227 1.0E-08
sp|Q54RT9|FNTA_DICDI Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha OS=Dictyostelium discoideum GN=fntA PE=3 SV=1 49 208 8.0E-08
sp|O60052|FNTA_SCHPO Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cwp1 PE=1 SV=1 36 256 1.0E-07
sp|A1L3L1|PTR1B_XENLA Protein prenyltransferase alpha subunit repeat-containing protein 1-B (Fragment) OS=Xenopus laevis GN=ptar1-b PE=2 SV=1 50 254 2.0E-06
sp|Q9LX33|FNTA_ARATH Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha OS=Arabidopsis thaliana GN=FTA PE=1 SV=2 104 208 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0008318 protein prenyltransferase activity Yes
GO:0018342 protein prenylation Yes
GO:0043170 macromolecule metabolic process No
GO:0140096 catalytic activity, acting on a protein No
GO:0019538 protein metabolic process No
GO:0044238 primary metabolic process No
GO:0008150 biological_process No
GO:0097354 prenylation No
GO:0008152 metabolic process No
GO:0016765 transferase activity, transferring alkyl or aryl (other than methyl) groups No
GO:0043412 macromolecule modification No
GO:0009987 cellular process No
GO:0006807 nitrogen compound metabolic process No
GO:0071704 organic substance metabolic process No
GO:0004659 prenyltransferase activity No
GO:0036211 protein modification process No
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:1901564 organonitrogen compound metabolic process No
GO:0044237 cellular metabolic process No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 43 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|390
MASHGVARIPQPTLTKHQREQQATKIRAYQALDHQVRTRVSAGHLDAHTFSLTTRLLQLNPEYYTIWNVRRRCLA
SPSSFASSPSSRTIDPSALRLDEPSIRSELAFTIPLLLQHPKCYWIWNHRLWILDQAIKHLPAHQARSIWQDELA
LVSKLLHKDRRNFHAWGYRRHVVSHLESPDLQGHSMVESEFHYTTTMISEDLSNFSAWHNRSQLIPRLLSQRAAD
ATSRKDFLYAELDLVHEALNVGPEDQSLWYYHRYLLSNISGKGDIAPDLSPCHRKAYLEHDMSNIRHLCLDYDGI
DSIYEALIQGTLILCKLKDQPLDSQSKQQPS*
Coding >OphauG2|390
ATGGCCAGCCACGGCGTGGCACGTATCCCCCAGCCCACTCTGACCAAGCATCAACGTGAGCAACAGGCCACCAAG
ATTCGTGCCTACCAAGCCCTCGATCATCAGGTGCGCACCCGTGTCTCGGCCGGCCACTTGGATGCCCACACCTTT
TCCCTCACCACGCGCCTGCTGCAACTCAACCCCGAGTACTATACTATCTGGAACGTCCGCCGCCGCTGTCTCGCA
TCTCCTTCTTCTTTCGCTTCCTCTCCCTCATCACGCACTATCGATCCCTCCGCTTTGCGCTTGGACGAACCTAGC
ATCCGCTCTGAACTGGCATTTACAATCCCTCTGCTCCTCCAGCACCCAAAATGCTATTGGATCTGGAATCATCGT
CTGTGGATCCTTGACCAGGCCATCAAGCACCTGCCTGCCCACCAAGCTCGCTCCATCTGGCAAGACGAGTTGGCC
CTGGTATCAAAGTTGCTGCACAAGGATCGCCGCAATTTTCACGCCTGGGGATACCGCCGCCATGTCGTCTCTCAT
CTCGAGAGCCCCGATCTGCAAGGCCATAGCATGGTCGAAAGCGAATTCCACTATACCACCACCATGATCAGTGAG
GACCTCTCAAACTTTTCAGCCTGGCACAATCGAAGCCAGCTTATCCCTCGACTCCTGAGCCAGCGTGCTGCCGAT
GCTACGTCTCGCAAGGATTTTCTCTATGCCGAGCTTGATCTTGTTCATGAAGCCTTGAATGTCGGTCCTGAAGAC
CAATCCTTGTGGTATTATCACCGCTATCTTCTCTCAAACATTTCAGGCAAGGGCGATATTGCTCCAGACTTGTCT
CCCTGCCATCGCAAGGCGTACCTTGAACATGACATGTCCAATATCCGCCATCTGTGCCTAGATTACGACGGCATT
GACTCGATTTATGAGGCTCTTATACAAGGCACTCTGATTCTCTGCAAACTAAAAGACCAACCTCTTGACAGCCAA
AGCAAACAACAACCCAGCTGA
Transcript >OphauG2|390
ATGGCCAGCCACGGCGTGGCACGTATCCCCCAGCCCACTCTGACCAAGCATCAACGTGAGCAACAGGCCACCAAG
ATTCGTGCCTACCAAGCCCTCGATCATCAGGTGCGCACCCGTGTCTCGGCCGGCCACTTGGATGCCCACACCTTT
TCCCTCACCACGCGCCTGCTGCAACTCAACCCCGAGTACTATACTATCTGGAACGTCCGCCGCCGCTGTCTCGCA
TCTCCTTCTTCTTTCGCTTCCTCTCCCTCATCACGCACTATCGATCCCTCCGCTTTGCGCTTGGACGAACCTAGC
ATCCGCTCTGAACTGGCATTTACAATCCCTCTGCTCCTCCAGCACCCAAAATGCTATTGGATCTGGAATCATCGT
CTGTGGATCCTTGACCAGGCCATCAAGCACCTGCCTGCCCACCAAGCTCGCTCCATCTGGCAAGACGAGTTGGCC
CTGGTATCAAAGTTGCTGCACAAGGATCGCCGCAATTTTCACGCCTGGGGATACCGCCGCCATGTCGTCTCTCAT
CTCGAGAGCCCCGATCTGCAAGGCCATAGCATGGTCGAAAGCGAATTCCACTATACCACCACCATGATCAGTGAG
GACCTCTCAAACTTTTCAGCCTGGCACAATCGAAGCCAGCTTATCCCTCGACTCCTGAGCCAGCGTGCTGCCGAT
GCTACGTCTCGCAAGGATTTTCTCTATGCCGAGCTTGATCTTGTTCATGAAGCCTTGAATGTCGGTCCTGAAGAC
CAATCCTTGTGGTATTATCACCGCTATCTTCTCTCAAACATTTCAGGCAAGGGCGATATTGCTCCAGACTTGTCT
CCCTGCCATCGCAAGGCGTACCTTGAACATGACATGTCCAATATCCGCCATCTGTGCCTAGATTACGACGGCATT
GACTCGATTTATGAGGCTCTTATACAAGGCACTCTGATTCTCTGCAAACTAAAAGACCAACCTCTTGACAGCCAA
AGCAAACAACAACCCAGCTGA
Gene >OphauG2|390
ATGGCCAGCGTAAGTCACGCCCTGCCCGCGCCCGTGGCCAAGTCCTGCTGCTGCTCCAGCCTGCTCCTCGACCCT
GCCACTCCAGCCATCCGTCAACTGATCACTTCATCCTAGCACGGCGTGGCACGTATCCCCCAGCCCACTCTGACC
AAGCATCAACGTGAGCAACAGGCCACCAAGATTCGTGCCTACCAAGCCCTCGATCATCAGGTGCGCACCCGTGTC
TCGGCCGGCCACTTGGATGCCCACACCTTTTCCCTCACCACGCGCCTGCTGCAACTCAACCCCGAGTACTATACT
ATCTGGAACGTCCGCCGCCGCTGTCTCGCATCTCCTTCTTCTTTCGCTTCCTCTCCCTCATCACGCACTATCGAT
CCCTCCGCTTTGCGCTTGGACGAACCTAGCATCCGCTCTGAACTGGCATTTACAATCCCTCTGCTCCTCCAGCAC
CCAAAATGCTATTGGATCTGGAATCATCGTCTGTGGATCCTTGACCAGGCCATCAAGCACCTGCCTGCCCACCAA
GCTCGCTCCATCTGGCAAGACGAGTTGGCCCTGGTATCAAAGTTGCTGCACAAGGATCGCCGCAATTTTCACGCC
TGGGGATACCGCCGCCATGTCGTCTCTCATCTCGAGAGCCCCGATCTGCAAGGCCATAGCATGGTCGAAAGCGAA
TTCCACTATACCACCACCATGATCAGTGAGGACCTCTCAAACTTTTCAGCCTGGCACAATCGAAGCCAGCTTATC
CCTCGACTCCTGAGCCAGCGTGCTGCCGATGCTACGTCTCGCAAGGATTTTCTCTATGCCGGTAAGACGCACACG
GCGCCCAATCTCAATCCGTCTAACCTCTTATGTATCGCAGAGCTTGATCTTGTTCATGAAGCCTTGAATGTCGGT
CCTGAAGACCAATCCTTGTGGTATTATCACCGCTATCTTCTCTCAAACATTTCAGGCAAGGGCGATATTGCTCCA
GACTTGTCTCCCTGCCATCGCAAGGCGTACCTTGAACATGACATGTCCAATATCCGCCATCTGTGCCTAGATTAC
GACGGCATTGACTCGATTTATGAGGCTCTTATACAAGGCACTCTGATTCTCTGCAAACTAAAAGACCAACCTCTT
GACAGCCAAAGCAAACAACAAGTTTTGCAATGGCTAGGCAAGCTGACGGAACTCGACCCCAAGCGCAACGGTCGT
TGGAATGATATCAAAGCCCAGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail