Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|3897
Gene name
LocationContig_306:7083..7834
Strand+
Gene length (bp)751
Transcript length (bp)609
Coding sequence length (bp)609
Protein length (aa) 203

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04699 P16-Arc ARP2/3 complex 16 kDa subunit (p16-Arc) 2.2E-53 15 202

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q10316|ARPC5_SCHPO Actin-related protein 2/3 complex subunit 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=arc5 PE=1 SV=1 16 197 6.0E-16
sp|P40518|ARPC5_YEAST Actin-related protein 2/3 complex subunit 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARC15 PE=1 SV=1 16 202 8.0E-13

GO

GO Term Description Terminal node
GO:0034314 Arp2/3 complex-mediated actin nucleation Yes
GO:0005885 Arp2/3 protein complex Yes
GO:0030833 regulation of actin filament polymerization Yes
GO:0015629 actin cytoskeleton Yes
GO:0050789 regulation of biological process No
GO:0016043 cellular component organization No
GO:0032956 regulation of actin cytoskeleton organization No
GO:0032991 protein-containing complex No
GO:0032271 regulation of protein polymerization No
GO:0008150 biological_process No
GO:0065008 regulation of biological quality No
GO:0007015 actin filament organization No
GO:0051128 regulation of cellular component organization No
GO:0110053 regulation of actin filament organization No
GO:0043226 organelle No
GO:0043254 regulation of protein-containing complex assembly No
GO:0097435 supramolecular fiber organization No
GO:0051493 regulation of cytoskeleton organization No
GO:0050794 regulation of cellular process No
GO:0090066 regulation of anatomical structure size No
GO:0043232 intracellular non-membrane-bounded organelle No
GO:0030832 regulation of actin filament length No
GO:0032970 regulation of actin filament-based process No
GO:1902903 regulation of supramolecular fiber organization No
GO:0044087 regulation of cellular component biogenesis No
GO:0110165 cellular anatomical entity No
GO:0008064 regulation of actin polymerization or depolymerization No
GO:0033043 regulation of organelle organization No
GO:0005856 cytoskeleton No
GO:0032535 regulation of cellular component size No
GO:0071840 cellular component organization or biogenesis No
GO:0045010 actin nucleation No
GO:0065007 biological regulation No
GO:0005575 cellular_component No
GO:0009987 cellular process No
GO:0043228 non-membrane-bounded organelle No
GO:0043229 intracellular organelle No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3864
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3897 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|6522
Ophiocordyceps camponoti-floridani Ophcf2|06613
Ophiocordyceps camponoti-rufipedis Ophun1|3228
Ophiocordyceps kimflemingae Ophio5|5016
Ophiocordyceps subramaniannii Hirsu2|7652

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|3897
MSIIQQHSNATLGDAWRTINIDALTEDSSVNFDTSTLRPPQPEVTEAEVRQLGGQVRQLLRGGDAEGALRGCLET
PVYNGTDAAKDAHLQTIVEVLQSIKASDMSPLVRGIYESPGGSECLDVLMKYIYKGMTMGHSPASAPKTPSRVTP
QSTGFSQFGSRHGASNEPAAAGMSVLLSWHEKLVDVAGLGCIGRTMTDWRRV*
Coding >OphauG2|3897
ATGTCCATCATTCAGCAGCACTCCAACGCGACGCTGGGCGACGCCTGGCGTACAATCAACATTGACGCCCTGACC
GAGGACTCTAGCGTCAACTTTGACACTTCGACGCTGCGGCCGCCGCAGCCAGAGGTGACGGAAGCTGAGGTGCGC
CAACTCGGGGGCCAGGTCCGCCAGCTGCTCAGGGGAGGCGATGCCGAGGGCGCGCTGAGGGGGTGTCTTGAGACA
CCGGTATACAACGGCACCGACGCCGCAAAGGACGCCCATCTTCAAACCATTGTTGAGGTCTTACAGTCCATCAAG
GCCAGCGACATGAGCCCCTTGGTTCGAGGCATCTACGAGTCTCCAGGCGGTAGCGAATGCTTGGACGTACTCATG
AAGTACATCTACAAGGGAATGACCATGGGCCATTCGCCAGCCAGCGCTCCCAAAACCCCATCCCGAGTCACGCCC
CAATCAACCGGCTTTAGTCAGTTTGGCTCGCGCCATGGAGCCTCAAACGAGCCGGCCGCCGCCGGAATGAGCGTG
CTGCTGAGCTGGCACGAAAAGCTTGTCGACGTGGCGGGACTGGGCTGCATAGGACGCACCATGACGGACTGGAGG
AGGGTATAG
Transcript >OphauG2|3897
ATGTCCATCATTCAGCAGCACTCCAACGCGACGCTGGGCGACGCCTGGCGTACAATCAACATTGACGCCCTGACC
GAGGACTCTAGCGTCAACTTTGACACTTCGACGCTGCGGCCGCCGCAGCCAGAGGTGACGGAAGCTGAGGTGCGC
CAACTCGGGGGCCAGGTCCGCCAGCTGCTCAGGGGAGGCGATGCCGAGGGCGCGCTGAGGGGGTGTCTTGAGACA
CCGGTATACAACGGCACCGACGCCGCAAAGGACGCCCATCTTCAAACCATTGTTGAGGTCTTACAGTCCATCAAG
GCCAGCGACATGAGCCCCTTGGTTCGAGGCATCTACGAGTCTCCAGGCGGTAGCGAATGCTTGGACGTACTCATG
AAGTACATCTACAAGGGAATGACCATGGGCCATTCGCCAGCCAGCGCTCCCAAAACCCCATCCCGAGTCACGCCC
CAATCAACCGGCTTTAGTCAGTTTGGCTCGCGCCATGGAGCCTCAAACGAGCCGGCCGCCGCCGGAATGAGCGTG
CTGCTGAGCTGGCACGAAAAGCTTGTCGACGTGGCGGGACTGGGCTGCATAGGACGCACCATGACGGACTGGAGG
AGGGTATAG
Gene >OphauG2|3897
ATGTCCATCATTCAGCAGCACTCCAACGCGACGCTGGGCGACGCCTGGCGTACAATCAACATTGACGCCCTGACC
GAGGACTCTAGCGTCAACTTTGACACTTCGACGCTGCGGCCGCCGCAGCCAGAGGTGACGGAAGCTGAGGTGCGC
CAACTCGGGGGCCAGGTCCGCCAGCTGCTCAGGGGAGGCGATGCCGAGGGCGCGCTGAGGGGGTGTCTTGAGACA
CCGGTATACAACGGCACCGACGCCGCAAAGGTGCGACTTGCTGGCGTCGTGGTCTGCAGCCCAAAGCATTCTAAA
CTGACTCTTGCGTCTTGGTGCTTTAGGACGCCCATCTTCAAACCATTGTTGAGGTCTTACAGTCCATCAAGGCCA
GCGACATGAGCCCCTTGGTTCGAGGCATCTACGAGTCTCCAGGCGGTAGCGAATGCTTGGACGTACTCATGAAGT
ACATGTTGGTGCTTTGCTGTCCCTGCCCTCCGCTCCTCTCCCAACACATTGGCTGACCATGGTGTGCCATGAAAG
CTACAAGGGAATGACCATGGGCCATTCGCCAGCCAGCGCTCCCAAAACCCCATCCCGAGTCACGCCCCAATCAAC
CGGCTTTAGTCAGTTTGGCTCGCGCCATGGAGCCTCAAACGAGCCGGCCGCCGCCGGAATGAGCGTGCTGCTGAG
CTGGCACGAAAAGCTTGTCGACGTGGCGGGACTGGGCTGCATAGGACGCACCATGACGGACTGGAGGAGGGTATA
G

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail