Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|3896
Gene name
LocationContig_305:15056..18742
Strand-
Gene length (bp)3686
Transcript length (bp)2946
Coding sequence length (bp)2946
Protein length (aa) 982

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup107
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3896 (this protein)
Ophiocordyceps australis 1348a (Ghana) OphauG2|7079
Ophiocordyceps australis map64 (Brazil) OphauB2|462
Ophiocordyceps australis map64 (Brazil) OphauB2|5003
Ophiocordyceps australis map64 (Brazil) OphauB2|82
Ophiocordyceps subramaniannii Hirsu2|10294
Ophiocordyceps subramaniannii Hirsu2|10486
Ophiocordyceps subramaniannii Hirsu2|138
Ophiocordyceps subramaniannii Hirsu2|3043
Ophiocordyceps subramaniannii Hirsu2|541
Ophiocordyceps subramaniannii Hirsu2|6468
Ophiocordyceps subramaniannii Hirsu2|7033
Ophiocordyceps subramaniannii Hirsu2|7055
Ophiocordyceps subramaniannii Hirsu2|7134
Ophiocordyceps subramaniannii Hirsu2|8285

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|3896
MKPVTGRSIWGVRALASPNFLQLRTYAKPVGACQYFETVSFQAPLLPRWVFYETPEEALLGFKRYWATFGFKPLR
SPWRFYLFRWEDDGAFMHIWNMDKSYDDEALHGGERILPPPANVYEMPGYLQHPSGILRPMLRILNDIFTSPVPV
ARDPDPAMQHALTSNASQMQAWFERITSHLHARCPTPNPDPEPMPSTSGVNHTQRCTQFIAQTIENDMPWVQNWI
QEMADAAGLPCPPENASSDPCPKESCDAAVAQVITGNPDFVQNWILDMAASFDLSCPTSAAHPDPHCIIAIDHAI
FNQDTWIREMIKLLLHYSGHKTCSDDSELANDVLQFLQDDFELSREQLIIVLAQGPQWLRQNFPQLLAVLFEFTQ
ASIGPLNCFQKPRFGKRTLQHRDTAQQDMLCRELLSDILDERKKAPGVYSCKKESLNQPCFFIEAKADECVVLTE
ALDKNTYWVRPEKTAGHCTLFSGHDCSDSGITTQFPGMALGNEVVSMFNNEIGSIRCDGIKTALEHKIRGCTSFD
DLTVYLKLGSGFGTGTWSKIYYLIGGSKTLFLAAHGPHGGSCIETKIDMIKAFGSATVPASYISTFTIWDVLNND
GIFSNPAALGGDKWLLESFRIDAHCASASKTLVYQVSINEMVSHDSHQINMPTPVKSVFIKPQDWTVASEYLPET
CQIGFADSEKHPTHECTEFSQLQLHVQLGSGYYQGTWDTLYLYFQRNERHVIASGPSPGFQKYMELDVPQVFKAP
KVAFSHLGLVEIYQYHDSILGNDDWKLHGIKLKARCANSLTEYQLDKYASVNYGVGDMNAPWHTSWRAWSASIDP
QKDWNQVFECSKLFQLSARINLCNKLSSGTSDDLFIRFETGNKKEFIFATRPSRGTAHSVMIYMSQAFRTPDVSV
GELKAFSILSRAHKNNTPDQWCLGTVILHATCAGSEKKLVHDTFNVYGWYERGRNFKAEINLKGWHLADANGNRA
GAPGDF*
Coding >OphauG2|3896
ATGAAACCAGTGACTGGTCGCAGCATTTGGGGAGTCCGTGCTCTTGCCAGCCCCAACTTTCTACAGCTCAGAACA
TACGCAAAGCCTGTTGGAGCATGTCAATACTTTGAAACGGTATCTTTTCAAGCCCCGTTGCTGCCTCGATGGGTC
TTTTATGAAACACCAGAAGAGGCGTTATTGGGATTCAAACGGTACTGGGCAACGTTTGGCTTCAAGCCTCTGAGA
AGCCCATGGCGGTTCTATCTTTTTCGATGGGAAGATGATGGTGCATTTATGCATATCTGGAACATGGACAAGTCG
TACGATGACGAAGCGCTGCACGGCGGAGAAAGAATTCTGCCACCTCCTGCAAATGTGTACGAAATGCCTGGCTAT
TTGCAACATCCGTCTGGGATTCTTCGCCCCATGCTGCGAATTCTCAACGATATATTCACAAGTCCAGTCCCTGTC
GCCCGAGACCCTGACCCAGCGATGCAGCACGCCCTGACTTCCAATGCTTCGCAGATGCAGGCTTGGTTTGAGAGG
ATTACAAGCCATCTCCATGCGCGTTGCCCGACCCCTAATCCAGATCCAGAGCCCATGCCAAGTACGTCGGGGGTT
AACCACACCCAGCGATGCACGCAATTCATTGCCCAGACCATTGAGAATGATATGCCTTGGGTGCAGAATTGGATC
CAGGAAATGGCCGATGCAGCAGGCCTGCCCTGTCCACCCGAAAACGCCAGCAGTGATCCATGCCCAAAAGAGAGC
TGTGACGCTGCCGTGGCTCAAGTCATTACTGGGAATCCCGACTTTGTCCAAAATTGGATATTGGACATGGCAGCA
TCGTTTGACTTGAGTTGCCCAACCTCTGCGGCTCACCCCGATCCTCACTGTATTATTGCCATAGATCATGCTATT
TTCAATCAAGACACATGGATCAGAGAAATGATAAAACTCCTGCTACACTATTCCGGCCATAAAACATGCTCTGAT
GACTCGGAGCTCGCCAATGACGTTTTGCAATTTTTGCAGGACGACTTTGAATTATCACGCGAGCAGCTCATCATC
GTTCTCGCCCAGGGCCCGCAATGGCTGCGGCAAAATTTCCCTCAGTTACTTGCCGTCTTGTTTGAGTTTACACAG
GCGTCGATTGGCCCGCTAAATTGCTTCCAGAAACCACGATTTGGCAAAAGGACTCTGCAGCATCGTGATACTGCT
CAGCAGGACATGCTGTGCCGAGAATTACTTTCTGATATCCTAGACGAACGGAAAAAGGCGCCTGGCGTGTATAGT
TGTAAAAAAGAGTCCTTGAATCAGCCGTGCTTCTTCATAGAAGCAAAGGCTGACGAGTGCGTTGTGCTCACCGAA
GCGTTGGACAAGAATACATACTGGGTACGGCCGGAGAAGACTGCTGGACACTGCACCCTATTTAGCGGCCACGAC
TGCTCCGACAGTGGCATCACGACTCAATTTCCTGGCATGGCTCTCGGAAACGAGGTAGTGTCCATGTTTAACAAC
GAGATTGGCTCTATTCGTTGCGACGGCATCAAGACAGCCCTTGAACACAAAATCCGCGGGTGCACCAGTTTCGAC
GACTTGACGGTGTACCTTAAGCTAGGATCCGGCTTCGGAACGGGGACCTGGTCCAAAATCTACTACTTAATCGGC
GGATCAAAGACGCTGTTTCTGGCCGCACACGGTCCGCATGGCGGGTCTTGTATTGAGACCAAGATTGACATGATT
AAAGCCTTTGGGTCCGCCACTGTTCCGGCGAGCTACATCAGCACTTTTACCATCTGGGATGTCCTTAATAACGAC
GGGATTTTTTCAAACCCTGCAGCACTGGGAGGCGATAAGTGGTTACTGGAAAGCTTTAGAATCGACGCGCACTGC
GCCTCAGCGTCAAAGACACTCGTTTACCAAGTCAGCATCAACGAGATGGTCTCTCACGACAGCCACCAGATCAAT
ATGCCGACCCCCGTAAAGTCGGTCTTTATTAAGCCTCAAGACTGGACCGTGGCTTCTGAATACCTACCCGAAACG
TGCCAAATCGGCTTTGCTGATTCGGAAAAGCATCCAACGCACGAATGCACTGAATTCAGCCAGCTCCAGCTTCAT
GTCCAACTGGGCAGCGGCTATTATCAAGGGACCTGGGATACTCTTTACCTCTATTTCCAACGAAATGAAAGGCAC
GTTATTGCTTCGGGGCCCAGTCCAGGATTCCAGAAGTATATGGAGCTTGATGTGCCGCAAGTATTCAAGGCTCCC
AAGGTGGCATTCAGTCACCTTGGATTGGTCGAGATTTACCAGTATCATGACAGCATTCTGGGGAATGACGACTGG
AAGCTTCACGGCATTAAGCTCAAGGCACGATGTGCCAACTCACTGACGGAATACCAACTTGACAAATATGCTTCG
GTCAACTACGGCGTTGGAGATATGAATGCCCCCTGGCACACGAGTTGGCGTGCCTGGTCTGCATCCATCGACCCC
CAAAAAGACTGGAATCAGGTGTTTGAGTGTAGCAAACTGTTTCAACTCTCTGCCAGGATCAACTTGTGTAATAAA
TTATCAAGTGGAACGTCGGACGACTTATTCATCAGGTTCGAGACGGGAAACAAGAAAGAGTTCATCTTTGCTACG
CGACCCAGTCGCGGCACAGCGCACAGTGTCATGATTTACATGAGCCAGGCTTTCAGGACGCCCGATGTTTCTGTG
GGAGAGCTCAAGGCTTTCTCAATCCTTTCGCGTGCCCATAAAAACAACACGCCCGATCAGTGGTGCCTCGGCACC
GTGATACTACACGCAACGTGTGCAGGCTCGGAAAAAAAATTGGTGCACGATACCTTTAACGTATATGGTTGGTAT
GAGCGTGGTCGAAACTTCAAGGCCGAGATTAATCTCAAAGGCTGGCACTTGGCTGACGCCAATGGGAACCGGGCC
GGCGCTCCAGGCGACTTTTGA
Transcript >OphauG2|3896
ATGAAACCAGTGACTGGTCGCAGCATTTGGGGAGTCCGTGCTCTTGCCAGCCCCAACTTTCTACAGCTCAGAACA
TACGCAAAGCCTGTTGGAGCATGTCAATACTTTGAAACGGTATCTTTTCAAGCCCCGTTGCTGCCTCGATGGGTC
TTTTATGAAACACCAGAAGAGGCGTTATTGGGATTCAAACGGTACTGGGCAACGTTTGGCTTCAAGCCTCTGAGA
AGCCCATGGCGGTTCTATCTTTTTCGATGGGAAGATGATGGTGCATTTATGCATATCTGGAACATGGACAAGTCG
TACGATGACGAAGCGCTGCACGGCGGAGAAAGAATTCTGCCACCTCCTGCAAATGTGTACGAAATGCCTGGCTAT
TTGCAACATCCGTCTGGGATTCTTCGCCCCATGCTGCGAATTCTCAACGATATATTCACAAGTCCAGTCCCTGTC
GCCCGAGACCCTGACCCAGCGATGCAGCACGCCCTGACTTCCAATGCTTCGCAGATGCAGGCTTGGTTTGAGAGG
ATTACAAGCCATCTCCATGCGCGTTGCCCGACCCCTAATCCAGATCCAGAGCCCATGCCAAGTACGTCGGGGGTT
AACCACACCCAGCGATGCACGCAATTCATTGCCCAGACCATTGAGAATGATATGCCTTGGGTGCAGAATTGGATC
CAGGAAATGGCCGATGCAGCAGGCCTGCCCTGTCCACCCGAAAACGCCAGCAGTGATCCATGCCCAAAAGAGAGC
TGTGACGCTGCCGTGGCTCAAGTCATTACTGGGAATCCCGACTTTGTCCAAAATTGGATATTGGACATGGCAGCA
TCGTTTGACTTGAGTTGCCCAACCTCTGCGGCTCACCCCGATCCTCACTGTATTATTGCCATAGATCATGCTATT
TTCAATCAAGACACATGGATCAGAGAAATGATAAAACTCCTGCTACACTATTCCGGCCATAAAACATGCTCTGAT
GACTCGGAGCTCGCCAATGACGTTTTGCAATTTTTGCAGGACGACTTTGAATTATCACGCGAGCAGCTCATCATC
GTTCTCGCCCAGGGCCCGCAATGGCTGCGGCAAAATTTCCCTCAGTTACTTGCCGTCTTGTTTGAGTTTACACAG
GCGTCGATTGGCCCGCTAAATTGCTTCCAGAAACCACGATTTGGCAAAAGGACTCTGCAGCATCGTGATACTGCT
CAGCAGGACATGCTGTGCCGAGAATTACTTTCTGATATCCTAGACGAACGGAAAAAGGCGCCTGGCGTGTATAGT
TGTAAAAAAGAGTCCTTGAATCAGCCGTGCTTCTTCATAGAAGCAAAGGCTGACGAGTGCGTTGTGCTCACCGAA
GCGTTGGACAAGAATACATACTGGGTACGGCCGGAGAAGACTGCTGGACACTGCACCCTATTTAGCGGCCACGAC
TGCTCCGACAGTGGCATCACGACTCAATTTCCTGGCATGGCTCTCGGAAACGAGGTAGTGTCCATGTTTAACAAC
GAGATTGGCTCTATTCGTTGCGACGGCATCAAGACAGCCCTTGAACACAAAATCCGCGGGTGCACCAGTTTCGAC
GACTTGACGGTGTACCTTAAGCTAGGATCCGGCTTCGGAACGGGGACCTGGTCCAAAATCTACTACTTAATCGGC
GGATCAAAGACGCTGTTTCTGGCCGCACACGGTCCGCATGGCGGGTCTTGTATTGAGACCAAGATTGACATGATT
AAAGCCTTTGGGTCCGCCACTGTTCCGGCGAGCTACATCAGCACTTTTACCATCTGGGATGTCCTTAATAACGAC
GGGATTTTTTCAAACCCTGCAGCACTGGGAGGCGATAAGTGGTTACTGGAAAGCTTTAGAATCGACGCGCACTGC
GCCTCAGCGTCAAAGACACTCGTTTACCAAGTCAGCATCAACGAGATGGTCTCTCACGACAGCCACCAGATCAAT
ATGCCGACCCCCGTAAAGTCGGTCTTTATTAAGCCTCAAGACTGGACCGTGGCTTCTGAATACCTACCCGAAACG
TGCCAAATCGGCTTTGCTGATTCGGAAAAGCATCCAACGCACGAATGCACTGAATTCAGCCAGCTCCAGCTTCAT
GTCCAACTGGGCAGCGGCTATTATCAAGGGACCTGGGATACTCTTTACCTCTATTTCCAACGAAATGAAAGGCAC
GTTATTGCTTCGGGGCCCAGTCCAGGATTCCAGAAGTATATGGAGCTTGATGTGCCGCAAGTATTCAAGGCTCCC
AAGGTGGCATTCAGTCACCTTGGATTGGTCGAGATTTACCAGTATCATGACAGCATTCTGGGGAATGACGACTGG
AAGCTTCACGGCATTAAGCTCAAGGCACGATGTGCCAACTCACTGACGGAATACCAACTTGACAAATATGCTTCG
GTCAACTACGGCGTTGGAGATATGAATGCCCCCTGGCACACGAGTTGGCGTGCCTGGTCTGCATCCATCGACCCC
CAAAAAGACTGGAATCAGGTGTTTGAGTGTAGCAAACTGTTTCAACTCTCTGCCAGGATCAACTTGTGTAATAAA
TTATCAAGTGGAACGTCGGACGACTTATTCATCAGGTTCGAGACGGGAAACAAGAAAGAGTTCATCTTTGCTACG
CGACCCAGTCGCGGCACAGCGCACAGTGTCATGATTTACATGAGCCAGGCTTTCAGGACGCCCGATGTTTCTGTG
GGAGAGCTCAAGGCTTTCTCAATCCTTTCGCGTGCCCATAAAAACAACACGCCCGATCAGTGGTGCCTCGGCACC
GTGATACTACACGCAACGTGTGCAGGCTCGGAAAAAAAATTGGTGCACGATACCTTTAACGTATATGGTTGGTAT
GAGCGTGGTCGAAACTTCAAGGCCGAGATTAATCTCAAAGGCTGGCACTTGGCTGACGCCAATGGGAACCGGGCC
GGCGCTCCAGGCGACTTTTGA
Gene >OphauG2|3896
ATGAAACCAGTGACTGGTCGCAGCATTTGGGGAGTCCGTGCTCTTGCCAGCCCCAACTTTCTACAGCTCAGAACA
TACGCAAAGCCTGTTGGAGCATGTCAATACTTTGAAACGGTATCTTTTCAAGCCCCGTTGCTGCCTCGATGGGTC
TTTTATGAAACACCAGAAGAGGCGTTATTGGGATTCAAACGGTACTGGGCAACGTTTGGCTTCAAGCCTCTGAGA
AGCCCATGGCGGTTCTATCTTTTTCGATGGGAAGATGATGGTGCATTTATGCATATCTGGAACATGGACAAGTCG
TACGATGACGAAGCGCTGCACGGCGGAGAAAGAATTCTGCCACCTCCTGCAAATGTGTACGAAATGCCTGGCTAT
TTGCAACATCCGTCTGGGATTCTTCGCCCCATGCTGCGAATTCTCAACGATATATTCACAAGTCCAGGTAACTGT
GCAAAAGCAGTCTGTTAATCATCAGGAGTGGTTCATTGATTAGATGACAGTCCCTGTCGCCCGAGACCCTGACCC
AGCGATGCAGCACGCCCTGACTTCCAATGCTTCGCAGATGCAGGCTTGGTTTGAGAGGATTACAAGCCATCTCCA
TGCGCGTTGCCCGACCCCTAATCCAGATCCAGAGCCCATGCCAAGTACGTCGGGGGTTAACCACACCCAGCGATG
CACGCAATTCATTGCCCAGAGTAAGCGACCACATTGTCTTGCTTGAAGCAGAAAAACAGTGGAAGGGAAGATGGC
TGATGCCTTGAAAGCCATTGAGAATGATATGCCTTGGGTGCAGAATTGGATCCAGGAAATGGCCGATGCAGCAGG
CCTGCCCTGTCCACCCGAAAACGCCAGCAGTGATCCATGCCCAAAAGAGAGCTGTGACGCTGCCGTGGCTCAAGG
TAGGTAGTAGGGCCATTTGCGCAGCGAGGTTGATGAATACTGACGTTGTATACCAAGTCATTACTGGGAATCCCG
ACTTTGTCCAAAATTGGATATTGGACATGGCAGCATCGTTTGACTTGAGTTGCCCAACCTCTGCGGCTCACCCCG
ATCCTCACTGTATTATTGCCATAGATCATGGTAGGCTTGTCTCTACTACACCTTGCCTTGTTTCCACTGCCTTTT
CCATGCCCTTTTATACTGCGTCTTGTTGTCCAAATGTTGCAACTTGCTGACCATTGTCGACCATGCAATAAGCTA
TTTTCAATCAAGACACATGGATCAGAGAAATGATAAAACTCCTGCTACACTATTCCGGCCATAAAACATGCTCTG
ATGACTCGGAGCTCGCCAATGACGTTTTGCAATTTTTGCAGGACGACTTTGAATTATCACGCGAGCAGCTCATCA
TCGTTCTCGCCCAGGGCCCGCAATGGCTGCGGCAAAATTTCCCTCAGTTACTTGCCGTCTTGTTTGAGTTTACAC
AGGCGTCGATTGGCCCGCTAAATTGCTTCCAGAAACCACGATTTGGCAAAAGGACTCTGCAGCATCGTGATACTG
GTAAGAGAGCTCTTGACTAACATCATGATACCATACTATTGCTGCATCACACGCATGTTGACGCTAGTCTTGCAT
ACATAGCTCAGCAGGACATGCTGTGCCGAGAATTACTTTCTGATATCCTAGACGAACGGAAAAAGGCGCCTGGCG
TGTATAGTTGTAAAAAAGAGTCCTTGAATCAGCCGTGCTTCTTCATAGAAGCAAAGGCTGACGAGTGCGGTACGG
AATCGTCCAACTCGTCTCCTTGTTTTGCTGCTCCAGCTAACAGCTTGCTACTAGTTGTGCTCACCGAAGCGTTGG
ACAAGAATACATACTGGGTACGGCCGGAGAAGACTGCTGGACACTGCACCCTATTTAGGTACTTGATACAAGATT
TTCTACCTCGTTTCTCTTTTTCTTTGTTGGTCCATCAAAACTAACTTGTTTCAACAGCGGCCACGACTGCTCCGA
CAGTGGCATCACGACTCAATTTCCTGGCATGGCTCTCGGAAACGAGGTAGTGTCCATGTTTAACAACGAGATTGG
CTCTATTCGTTGCGACGGCATCAAGACAGCCCTTGAACACAAAATCCGCGGGTGCACCAGTTTCGACGACTTGAC
GGTGTACCTTAAGCTAGGATCCGGCTTCGGAACGGGGACCTGGTCCAAAATCTACTACTTAATCGGCGGATCAAA
GACGCTGTTTCTGGCCGCACACGGTCCGCATGGCGGGTCTTGTATTGAGACCAAGATTGACATGATTAAAGCCTT
TGGGTCCGCCACTGTTCCGGCGAGCTACATCAGCACTTTTACCATCTGGGATGTCCTTAATAACGACGGGATTTT
TTCAAACCCTGCAGCACTGGGAGGCGATAAGTGGTTACTGGAAAGTAAGACTTGCGCAAAGGATATCAATCAAAG
GCGAGACGGGTATTGATTCCAGTCTTTAGGCTTTAGAATCGACGCGCACTGCGCCTCAGCGTCAAAGACACTCGT
TTACCAAGTCAGCATCAACGAGATGGTCTCTCACGACAGCCACCAGATCAATATGCCGACCCCCGTAAAGTCGGT
CTTTATTAAGCCTCAAGACTGGACCGTGGCTTCTGAATACCTACCCGAAACGTGCCAAATCGGCTTTGCTGATTC
GGAAAAGCATCCAACGCACGAATGCACTGAATTCAGCCAGCTCCAGCTTCATGTCCAACTGGGCAGCGGCTATTA
TCAAGGGACCTGGGATACTCTTTACCTCTATTTCCAACGAAATGAAAGGCACGTTATTGCTTCGGGGCCCAGTCC
AGGATTCCAGAAGTATATGGAGCTTGATGTGCCGCAAGTATTCAAGGCTCCCAAGGTGGCATTCAGTCACCTTGG
ATTGGTCGAGATTTACCAGTATCATGACAGCATTCTGGGGAATGACGACTGGAAGCTTCACGGTATAGTCCCCGC
TCCCAACACCATGGCTTGGACCCATGGCTTGGACCCATGGCTTGAACCCATGGCTTGGACACTCACTCACTCGGG
TTGTACTAGGCATTAAGCTCAAGGCACGATGTGCCAACTCACTGACGGAATACCAACTTGACAAATATGCTTCGG
TCAACTACGGCGTTGGAGATATGAATGCCCCCTGGCACACGAGTTGGCGTGCCTGGTCTGCATCCATCGACCCCC
AAAAAGACTGGAATCAGGTGTTTGAGTGTAGCAAACTGTTTCAACTCTCTGCCAGGATCAACTTGTGTAATAAAT
TATCAAGTGGAACGTCGGACGACTTATTCATCAGGTTCGAGACGGGAAACAAGAAAGAGTTCATCTTTGCTACGC
GACCCAGTCGCGGCACAGCGCACAGTGTCATGATTTACATGAGCCAGGCTTTCAGGACGCCCGATGTTTCTGTGG
GAGAGCTCAAGGCTTTCTCAATCCTTTCGCGTGCCCATAAAAACAACACGCCCGATCAGTGGTGCCTCGGCAGTA
AGTAGACTGTTTGTTTCTTGATGATTCCATAATAAAAAGAAGCATTACTGACTGCTTGTCCAGCCGTGATACTAC
ACGCAACGTGTGCAGGCTCGGAAAAAAAATTGGTGCACGATACCTTTAACGTATATGGTTGGTATGAGCGTGGTC
GAAACTTCAAGGCCGAGATTAATCTCAAAGGCTGGCACTTGGCTGACGCCAATGGGAACCGGGCCGGCGCTCCAG
GCGACTTTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail