Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|3888
Gene name
LocationContig_304:13063..14040
Strand-
Gene length (bp)977
Transcript length (bp)855
Coding sequence length (bp)855
Protein length (aa) 285

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 1.7E-13 35 104

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|B0BN49|RBMX2_RAT RNA-binding motif protein, X-linked 2 OS=Rattus norvegicus GN=Rbmx2 PE=2 SV=1 1 118 2.0E-39
sp|Q9Y388|RBMX2_HUMAN RNA-binding motif protein, X-linked 2 OS=Homo sapiens GN=RBMX2 PE=1 SV=2 1 118 3.0E-39
sp|P40565|IST3_YEAST U2 snRNP component IST3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IST3 PE=1 SV=1 1 114 2.0E-38
sp|Q8R0F5|RBMX2_MOUSE RNA-binding motif protein, X-linked 2 OS=Mus musculus GN=Rbmx2 PE=1 SV=1 1 118 4.0E-38
sp|O94290|IST3_SCHPO U2 snRNP component ist3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cwf29 PE=1 SV=1 1 123 7.0E-38
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|B0BN49|RBMX2_RAT RNA-binding motif protein, X-linked 2 OS=Rattus norvegicus GN=Rbmx2 PE=2 SV=1 1 118 2.0E-39
sp|Q9Y388|RBMX2_HUMAN RNA-binding motif protein, X-linked 2 OS=Homo sapiens GN=RBMX2 PE=1 SV=2 1 118 3.0E-39
sp|P40565|IST3_YEAST U2 snRNP component IST3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IST3 PE=1 SV=1 1 114 2.0E-38
sp|Q8R0F5|RBMX2_MOUSE RNA-binding motif protein, X-linked 2 OS=Mus musculus GN=Rbmx2 PE=1 SV=1 1 118 4.0E-38
sp|O94290|IST3_SCHPO U2 snRNP component ist3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cwf29 PE=1 SV=1 1 123 7.0E-38
sp|Q9SD61|C3H42_ARATH Zinc finger CCCH domain-containing protein 42 OS=Arabidopsis thaliana GN=At3g47120 PE=2 SV=1 1 119 5.0E-35
sp|Q10B98|C3H25_ORYSJ Zinc finger CCCH domain-containing protein 25 OS=Oryza sativa subsp. japonica GN=Os03g0826400 PE=2 SV=1 1 108 2.0E-34
sp|Q8BIQ5|CSTF2_MOUSE Cleavage stimulation factor subunit 2 OS=Mus musculus GN=Cstf2 PE=1 SV=2 30 178 3.0E-15
sp|Q8HXM1|CSTF2_BOVIN Cleavage stimulation factor subunit 2 OS=Bos taurus GN=CSTF2 PE=2 SV=1 30 178 3.0E-15
sp|P33240|CSTF2_HUMAN Cleavage stimulation factor subunit 2 OS=Homo sapiens GN=CSTF2 PE=1 SV=1 30 178 6.0E-15
sp|Q5RDA3|CSTF2_PONAB Cleavage stimulation factor subunit 2 OS=Pongo abelii GN=CSTF2 PE=2 SV=1 30 178 6.0E-15
sp|Q8C7E9|CSTFT_MOUSE Cleavage stimulation factor subunit 2 tau variant OS=Mus musculus GN=Cstf2t PE=1 SV=2 30 177 2.0E-13
sp|Q9H0L4|CSTFT_HUMAN Cleavage stimulation factor subunit 2 tau variant OS=Homo sapiens GN=CSTF2T PE=1 SV=1 30 177 2.0E-13
sp|Q05966|GRP10_BRANA Glycine-rich RNA-binding protein 10 OS=Brassica napus GN=GRP10 PE=2 SV=1 26 110 2.0E-11
sp|P49311|GRP2_SINAL Glycine-rich RNA-binding protein GRP2A OS=Sinapis alba PE=2 SV=1 35 110 4.0E-11
sp|O43040|CTF1_SCHPO Cleavage and termination factor 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ctf1 PE=1 SV=1 35 118 4.0E-11
sp|Q9FGS0|CP31B_ARATH RNA-binding protein CP31B, chloroplastic OS=Arabidopsis thaliana GN=CP31B PE=1 SV=1 31 114 5.0E-10
sp|Q03251|RBG8_ARATH Glycine-rich RNA-binding protein 8 OS=Arabidopsis thaliana GN=RBG8 PE=1 SV=1 26 110 5.0E-10
sp|Q9P6P7|YKCG_SCHPO Uncharacterized RNA-binding protein C644.16 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC644.16 PE=3 SV=1 32 107 6.0E-10
sp|P25299|RNA15_YEAST mRNA 3'-end-processing protein RNA15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RNA15 PE=1 SV=1 35 109 7.0E-10
sp|O23212|U2A2A_ARATH Splicing factor U2af large subunit A OS=Arabidopsis thaliana GN=U2AF65A PE=2 SV=2 18 109 1.0E-09
sp|Q9WX37|RBPE_NOSS1 Putative RNA-binding protein RbpE OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=rbpE PE=3 SV=3 35 126 1.0E-09
sp|P49310|GRP1_SINAL Glycine-rich RNA-binding protein GRP1A OS=Sinapis alba PE=2 SV=1 35 110 2.0E-09
sp|Q2QKB3|U2A2A_WHEAT Splicing factor U2af large subunit A OS=Triticum aestivum GN=U2AF65A PE=2 SV=1 18 109 2.0E-09
sp|Q2QZL4|U2A2B_ORYSJ Splicing factor U2af large subunit B OS=Oryza sativa subsp. japonica GN=U2AF65B PE=3 SV=2 18 118 3.0E-09
sp|Q2QKB4|U2A2B_WHEAT Splicing factor U2af large subunit B OS=Triticum aestivum GN=U2AF65B PE=2 SV=1 18 109 3.0E-09
sp|Q9ZR39|U2A2A_NICPL Splicing factor U2af large subunit A OS=Nicotiana plumbaginifolia GN=U2AF65A PE=2 SV=1 18 109 3.0E-09
sp|Q9ZR40|U2A2B_NICPL Splicing factor U2af large subunit B OS=Nicotiana plumbaginifolia GN=U2AF65B PE=2 SV=1 18 109 3.0E-09
sp|Q2R0Q1|U2A2A_ORYSJ Splicing factor U2af large subunit A OS=Oryza sativa subsp. japonica GN=U2AF65A PE=2 SV=2 18 118 3.0E-09
sp|Q9M9G6|CTF64_ARATH Cleavage stimulating factor 64 OS=Arabidopsis thaliana GN=CSTF64 PE=1 SV=1 35 109 5.0E-09
sp|Q03878|GRP1_DAUCA Glycine-rich RNA-binding protein OS=Daucus carota PE=2 SV=1 26 110 6.0E-09
sp|P28644|ROC1_SPIOL 28 kDa ribonucleoprotein, chloroplastic OS=Spinacia oleracea PE=1 SV=1 20 114 8.0E-09
sp|Q04836|CP31A_ARATH 31 kDa ribonucleoprotein, chloroplastic OS=Arabidopsis thaliana GN=CP31A PE=1 SV=1 35 113 1.0E-08
sp|P19682|ROC3_NICSY 28 kDa ribonucleoprotein, chloroplastic OS=Nicotiana sylvestris PE=1 SV=1 29 114 1.0E-08
sp|Q03250|RBG7_ARATH Glycine-rich RNA-binding protein 7 OS=Arabidopsis thaliana GN=RBG7 PE=1 SV=1 23 110 2.0E-08
sp|Q44556|RBPD_NOSS1 Putative RNA-binding protein RbpD OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=rbpD PE=3 SV=3 35 117 3.0E-08
sp|Q13310|PABP4_HUMAN Polyadenylate-binding protein 4 OS=Homo sapiens GN=PABPC4 PE=1 SV=1 11 131 3.0E-08
sp|Q57014|RBPA_SYNY3 Putative RNA-binding protein RbpA OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=rbpA PE=3 SV=3 35 116 3.0E-08
sp|Q00916|RU17_YEAST U1 small nuclear ribonucleoprotein 70 kDa homolog OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNP1 PE=1 SV=1 1 110 4.0E-08
sp|Q8L716|U2A2B_ARATH Splicing factor U2af large subunit B OS=Arabidopsis thaliana GN=U2AF65B PE=2 SV=2 18 109 4.0E-08
sp|Q9SVM8|RBG2_ARATH Glycine-rich RNA-binding protein 2, mitochondrial OS=Arabidopsis thaliana GN=RBG2 PE=1 SV=1 35 113 1.0E-07
sp|P10979|GRPA_MAIZE Glycine-rich RNA-binding, abscisic acid-inducible protein OS=Zea mays GN=RAB15 PE=1 SV=1 28 110 1.0E-07
sp|Q5RC80|RBM39_PONAB RNA-binding protein 39 OS=Pongo abelii GN=RBM39 PE=2 SV=1 35 108 1.0E-07
sp|Q8VH51|RBM39_MOUSE RNA-binding protein 39 OS=Mus musculus GN=Rbm39 PE=1 SV=2 35 108 1.0E-07
sp|Q14498|RBM39_HUMAN RNA-binding protein 39 OS=Homo sapiens GN=RBM39 PE=1 SV=2 35 108 1.0E-07
sp|Q9SIX3|RBG1_ARATH Probable glycine-rich RNA-binding protein 1 OS=Arabidopsis thaliana GN=RBG1 PE=2 SV=2 29 104 2.0E-07
sp|P31483|TIA1_HUMAN Nucleolysin TIA-1 isoform p40 OS=Homo sapiens GN=TIA1 PE=1 SV=3 30 113 3.0E-07
sp|Q99070|GRP2_SORBI Glycine-rich RNA-binding protein 2 OS=Sorghum bicolor GN=GRP2 PE=2 SV=1 28 110 3.0E-07
sp|P52912|TIA1_MOUSE Nucleolysin TIA-1 OS=Mus musculus GN=Tia1 PE=1 SV=1 30 113 3.0E-07
sp|Q08935|ROC1_NICSY 29 kDa ribonucleoprotein A, chloroplastic OS=Nicotiana sylvestris PE=2 SV=1 35 113 3.0E-07
sp|P19683|ROC4_NICSY 31 kDa ribonucleoprotein, chloroplastic OS=Nicotiana sylvestris PE=1 SV=1 21 116 3.0E-07
sp|P49313|ROC1_NICPL 30 kDa ribonucleoprotein, chloroplastic OS=Nicotiana plumbaginifolia PE=2 SV=1 35 113 4.0E-07
sp|P70318|TIAR_MOUSE Nucleolysin TIAR OS=Mus musculus GN=Tial1 PE=1 SV=1 35 113 6.0E-07
sp|Q01085|TIAR_HUMAN Nucleolysin TIAR OS=Homo sapiens GN=TIAL1 PE=1 SV=1 35 113 7.0E-07
sp|Q08937|ROC2_NICSY 29 kDa ribonucleoprotein B, chloroplastic OS=Nicotiana sylvestris PE=2 SV=1 35 114 7.0E-07
sp|Q24562|U2AF2_DROME Splicing factor U2AF 50 kDa subunit OS=Drosophila melanogaster GN=U2af50 PE=1 SV=1 35 120 9.0E-07
sp|Q86U06|RBM23_HUMAN Probable RNA-binding protein 23 OS=Homo sapiens GN=RBM23 PE=1 SV=1 35 108 1.0E-06
sp|Q8RWN5|RZ1C_ARATH Glycine-rich RNA-binding protein RZ1C OS=Arabidopsis thaliana GN=RZ1C PE=1 SV=1 35 109 1.0E-06
sp|P49314|ROC2_NICPL 31 kDa ribonucleoprotein, chloroplastic OS=Nicotiana plumbaginifolia PE=2 SV=1 35 114 1.0E-06
sp|Q10422|YDC1_SCHPO Uncharacterized RNA-binding protein C25G10.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC25G10.01 PE=1 SV=1 35 136 1.0E-06
sp|Q44554|RBPB_NOSS1 Putative RNA-binding protein RbpB OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=rbpB PE=3 SV=3 35 116 1.0E-06
sp|Q6DJI9|ZCRB1_XENLA Zinc finger CCHC-type and RNA-binding motif-containing protein 1 OS=Xenopus laevis GN=zcrb1 PE=2 SV=1 35 110 2.0E-06
sp|Q2HJG2|PUF60_BOVIN Poly(U)-binding-splicing factor PUF60 OS=Bos taurus GN=PUF60 PE=2 SV=1 35 113 2.0E-06
sp|Q9WX39|RBPF_NOSS1 Putative RNA-binding protein RbpF OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=rbpF PE=3 SV=3 35 116 2.0E-06
sp|Q43472|GRP_HORVU Glycine-rich RNA-binding protein blt801 OS=Hordeum vulgare GN=blt801 PE=1 SV=1 35 115 2.0E-06
sp|Q9ZUU4|CP29B_ARATH RNA-binding protein CP29B, chloroplastic OS=Arabidopsis thaliana GN=CP29B PE=1 SV=1 35 113 2.0E-06
sp|Q8CH84|ELAV2_RAT ELAV-like protein 2 OS=Rattus norvegicus GN=Elavl2 PE=1 SV=1 40 110 3.0E-06
sp|Q60899|ELAV2_MOUSE ELAV-like protein 2 OS=Mus musculus GN=Elavl2 PE=2 SV=1 40 110 3.0E-06
sp|Q12926|ELAV2_HUMAN ELAV-like protein 2 OS=Homo sapiens GN=ELAVL2 PE=1 SV=2 40 110 3.0E-06
sp|Q5R9Z6|ELAV2_PONAB ELAV-like protein 2 OS=Pongo abelii GN=ELAVL2 PE=2 SV=1 40 110 3.0E-06
sp|Q3UEB3|PUF60_MOUSE Poly(U)-binding-splicing factor PUF60 OS=Mus musculus GN=Puf60 PE=1 SV=2 35 113 3.0E-06
sp|Q5R469|PUF60_PONAB Poly(U)-binding-splicing factor PUF60 OS=Pongo abelii GN=PUF60 PE=2 SV=1 35 113 3.0E-06
sp|Q9UHX1|PUF60_HUMAN Poly(U)-binding-splicing factor PUF60 OS=Homo sapiens GN=PUF60 PE=1 SV=1 35 113 3.0E-06
sp|Q4G338|PPIE_HAECO Peptidyl-prolyl cis-trans isomerase E OS=Haemonchus contortus PE=1 SV=1 35 110 3.0E-06
sp|Q9FNR1|RBG3_ARATH Glycine-rich RNA-binding protein 3, mitochondrial OS=Arabidopsis thaliana GN=RBG3 PE=2 SV=1 35 109 3.0E-06
sp|Q9WV25|PUF60_RAT Poly(U)-binding-splicing factor PUF60 OS=Rattus norvegicus GN=Puf60 PE=2 SV=2 35 113 3.0E-06
sp|P0CB38|PAB4L_HUMAN Polyadenylate-binding protein 4-like OS=Homo sapiens GN=PABPC4L PE=2 SV=1 11 131 4.0E-06
sp|Q0CR95|PABP_ASPTN Polyadenylate-binding protein, cytoplasmic and nuclear OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=pab1 PE=3 SV=1 35 118 4.0E-06
sp|P26369|U2AF2_MOUSE Splicing factor U2AF 65 kDa subunit OS=Mus musculus GN=U2af2 PE=1 SV=3 35 109 4.0E-06
sp|Q28GD4|ELAV2_XENTR ELAV-like protein 2 OS=Xenopus tropicalis GN=elavl2 PE=2 SV=2 40 110 4.0E-06
sp|P26368|U2AF2_HUMAN Splicing factor U2AF 65 kDa subunit OS=Homo sapiens GN=U2AF2 PE=1 SV=4 35 109 4.0E-06
sp|Q44560|RBPA_NOSS1 Putative RNA-binding protein RbpA OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=rbpA PE=3 SV=3 35 120 4.0E-06
sp|Q8LFS6|BRN1L_ARATH RNA-binding protein BRN1 OS=Arabidopsis thaliana GN=BRN1 PE=2 SV=1 18 110 4.0E-06
sp|P26378|ELAV4_HUMAN ELAV-like protein 4 OS=Homo sapiens GN=ELAVL4 PE=1 SV=2 40 110 5.0E-06
sp|O09032|ELAV4_RAT ELAV-like protein 4 OS=Rattus norvegicus GN=Elavl4 PE=1 SV=1 40 110 6.0E-06
sp|Q91584|ELAV3_XENLA ELAV-like protein 3 OS=Xenopus laevis GN=elavl3 PE=2 SV=1 40 110 6.0E-06
sp|Q61701|ELAV4_MOUSE ELAV-like protein 4 OS=Mus musculus GN=Elavl4 PE=1 SV=1 40 110 6.0E-06
sp|Q9LIS2|RBG4_ARATH Glycine-rich RNA-binding protein 4, mitochondrial OS=Arabidopsis thaliana GN=RBG4 PE=2 SV=1 35 109 7.0E-06
sp|Q28FX0|ELAV3_XENTR ELAV-like protein 3 OS=Xenopus tropicalis GN=elavl3 PE=2 SV=1 40 110 7.0E-06
sp|Q9FMG4|SC35_ARATH Serine/arginine-rich splicing factor SC35 OS=Arabidopsis thaliana GN=SC35 PE=1 SV=1 28 113 8.0E-06
sp|Q99383|HRP1_YEAST Nuclear polyadenylated RNA-binding protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HRP1 PE=1 SV=1 30 118 8.0E-06
sp|O22703|RZ1B_ARATH Glycine-rich RNA-binding protein RZ1B OS=Arabidopsis thaliana GN=RZ1B PE=2 SV=1 35 109 8.0E-06
sp|Q9P3U1|YKX5_SCHPO Uncharacterized RNA-binding protein C328.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC328.05 PE=3 SV=3 35 111 9.0E-06
sp|O94432|YHKF_SCHPO Uncharacterized RNA-binding protein C660.15 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC660.15 PE=3 SV=1 30 118 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:0003674 molecular_function No
GO:1901363 heterocyclic compound binding No
GO:0005488 binding No
GO:0003676 nucleic acid binding No
GO:0097159 organic cyclic compound binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 48 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|3888
MNKIRAIQALNQKEIEQGISPNASWHTDYRDTAFVYFGGLPYELSEGDVITIFSQFGEPVFLKLVRDAETGKSKG
FGWLKYQDQRSTDLAVDNLGGAHIGGRLIGVDHARYKPRDDEDPAEFAVGWEDMRRREGLPVSEDEASDAASNVP
PPLLPEERQLMNLMNNHDDDDPMKIENMDTMGLPSTDDMTMRRAPDDTETMLLPMNCDAVVTTSIVAKGLPLTQL
QVAIQSALPAGQGKDLLPTTLMLTIAPKHLVETTRAIPDPKDTATTLAMPDPKDTATTR*
Coding >OphauG2|3888
ATGAACAAGATTCGCGCCATCCAGGCCCTCAATCAGAAAGAGATTGAGCAGGGCATCTCCCCCAATGCCTCATGG
CATACCGACTACCGCGACACCGCCTTTGTCTACTTTGGCGGCCTTCCATACGAGCTATCTGAAGGCGACGTCATT
ACCATTTTTTCACAATTCGGCGAGCCCGTCTTCCTCAAGCTAGTCCGCGACGCAGAAACGGGCAAGTCCAAAGGC
TTTGGCTGGCTCAAGTACCAAGACCAGCGCAGCACCGATCTCGCCGTCGATAACCTTGGCGGCGCTCATATTGGC
GGCCGCCTCATTGGGGTCGACCATGCGCGCTACAAGCCCCGCGATGACGAGGATCCGGCCGAGTTTGCCGTTGGC
TGGGAGGATATGCGGCGACGAGAGGGGCTGCCCGTGTCAGAGGATGAAGCCAGCGATGCCGCCAGCAACGTGCCA
CCGCCACTGCTGCCAGAGGAGCGTCAGCTGATGAACCTGATGAACAACCACGACGACGACGACCCTATGAAGATC
GAAAACATGGACACCATGGGTCTTCCAAGCACAGACGACATGACGATGCGACGCGCTCCAGACGACACCGAGACG
ATGCTTCTCCCCATGAATTGCGACGCAGTCGTCACCACGAGCATCGTCGCAAAAGGCTTGCCCCTGACACAACTA
CAGGTCGCGATACAGAGCGCTCTCCCAGCAGGACAAGGCAAAGACCTACTTCCCACGACTCTGATGCTGACCATT
GCTCCAAAACATCTCGTCGAGACGACTCGCGCGATTCCCGATCCAAAAGACACCGCGACGACTCTCGCGATGCCC
GATCCAAAAGACACCGCGACGACTCGGTAG
Transcript >OphauG2|3888
ATGAACAAGATTCGCGCCATCCAGGCCCTCAATCAGAAAGAGATTGAGCAGGGCATCTCCCCCAATGCCTCATGG
CATACCGACTACCGCGACACCGCCTTTGTCTACTTTGGCGGCCTTCCATACGAGCTATCTGAAGGCGACGTCATT
ACCATTTTTTCACAATTCGGCGAGCCCGTCTTCCTCAAGCTAGTCCGCGACGCAGAAACGGGCAAGTCCAAAGGC
TTTGGCTGGCTCAAGTACCAAGACCAGCGCAGCACCGATCTCGCCGTCGATAACCTTGGCGGCGCTCATATTGGC
GGCCGCCTCATTGGGGTCGACCATGCGCGCTACAAGCCCCGCGATGACGAGGATCCGGCCGAGTTTGCCGTTGGC
TGGGAGGATATGCGGCGACGAGAGGGGCTGCCCGTGTCAGAGGATGAAGCCAGCGATGCCGCCAGCAACGTGCCA
CCGCCACTGCTGCCAGAGGAGCGTCAGCTGATGAACCTGATGAACAACCACGACGACGACGACCCTATGAAGATC
GAAAACATGGACACCATGGGTCTTCCAAGCACAGACGACATGACGATGCGACGCGCTCCAGACGACACCGAGACG
ATGCTTCTCCCCATGAATTGCGACGCAGTCGTCACCACGAGCATCGTCGCAAAAGGCTTGCCCCTGACACAACTA
CAGGTCGCGATACAGAGCGCTCTCCCAGCAGGACAAGGCAAAGACCTACTTCCCACGACTCTGATGCTGACCATT
GCTCCAAAACATCTCGTCGAGACGACTCGCGCGATTCCCGATCCAAAAGACACCGCGACGACTCTCGCGATGCCC
GATCCAAAAGACACCGCGACGACTCGGTAG
Gene >OphauG2|3888
ATGAACAAGATTCGCGCCATCCAGGCCCTCAATCAGAAAGAGATTGAGCAGGGCATGTACGTGAATACACCCTCC
TGTCAACTCTCATCTACTGACGCCTGATTGCAGCTCCCCCAATGCCTCATGGCATACCGACTACCGCGACACCGC
CTTTGTCTACTTTGGCGGCCTTCCATACGAGCTATCTGAAGGCGACGTCATTACCATTTTTTCACAATTCGGCGA
GCCCGTCTTCCTCAAGCTAGTCCGCGACGCAGAAACGGGCAAGTCCAAAGGCTTTGGCTGGCTCAAGTACCAAGA
CCAGCGCAGCACCGATCTCGCCGTCGATAACCTTGGCGGCGCTCATATTGGCGGCCGCCTCATTGGGGTCGACCA
TGCGCGCTACAAGCCCCGCGATGACGAGGATCCGGCCGAGTTTGCCGTTGGCTGGGAGGATATGCGGCGACGAGA
GGGGCTGCCCGTGTCAGAGGATGAAGCCAGCGATGCCGCCAGCAACGTGCCACCGCCACTGCTGCCAGAGGAGCG
TCAGCTGATGAACCTGATGAACAACCACGACGACGACGACCCTATGAAGATGTATCTCATTGAAGAAAAGAGAAA
AGAGGTGCAAGAGGCGCGTGCAAGGGCTGACAGCAAGGACCGGAAGCGAAAACATGGACACCATGGGTCTTCCAA
GCACAGACGACATGACGATGCGACGCGCTCCAGACGACACCGAGACGATGCTTCTCCCCATGAATTGCGACGCAG
TCGTCACCACGAGCATCGTCGCAAAAGGCTTGCCCCTGACACAACTACAGGTCGCGATACAGAGCGCTCTCCCAG
CAGGACAAGGCAAAGACCTACTTCCCACGACTCTGATGCTGACCATTGCTCCAAAACATCTCGTCGAGACGACTC
GCGCGATTCCCGATCCAAAAGACACCGCGACGACTCTCGCGATGCCCGATCCAAAAGACACCGCGACGACTCGGT
AG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail