Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|3879
Gene name
LocationContig_303:10467..13075
Strand-
Gene length (bp)2608
Transcript length (bp)2484
Coding sequence length (bp)2484
Protein length (aa) 828

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q59VQ8|WAR1_CANAL Transcriptional regulator WAR1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=WAR1 PE=1 SV=1 229 566 6.0E-09
sp|A2ASS6|TITIN_MOUSE Titin OS=Mus musculus GN=Ttn PE=1 SV=1 75 194 3.0E-08
sp|A2ASS6|TITIN_MOUSE Titin OS=Mus musculus GN=Ttn PE=1 SV=1 75 241 5.0E-07
sp|A2ASS6|TITIN_MOUSE Titin OS=Mus musculus GN=Ttn PE=1 SV=1 75 246 7.0E-07

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|3879
MKTAALASALLATVVAAQPRGYAMRHKNVARDMVTETEWVVETAFVTEVIDASTTFIMPAGATPDSDSDGTFFEP
PAAPEPEATPVEASPPPPSAAPQAQDKPAGAPEKPQQPVAGPPAAQQPVAQPPPPPQQPVAQPPPPQNPPAQQAP
PERPTAQPIPQPAPQPTPQPAPQPAPQPAPQPAPQPQLERPASPSAIAPNYNSFALPGCICWPVHADSPPPPESD
DALLQTYRRDMQPVHPFVIIPPSCTAAALAASRPFLMSAIRMAASFRNLRCMTAQMSQLMLHLSDYMLVRSQRSL
DLLQGIIVMLGWYQYHCFQHAQMNNLIALAVSLVGELGLNRPPVLREQASLMVARPEKPAGRTNEERRACAAVWY
LNSVMATSFGRLEPMRYSAYLQQCIKELEASHEYETDVTLVFLLRLQHLTDCIHENNCRDTAVDTFHGIPTAPAS
VYVQAFQSELNRLSSKLPAHLKADKTIQIFLHTASLRLYEPPIADLAHIKQLSELLTTGSIGAGTPLDKMYQTNA
ALRAWFDTWLSIPVATYCIQPAAVAAQFVYAIVMLGRWAKLATPRTMYHGGTPMPSTGTSSMSEYAADQRPGPCS
ADRAESWPCQTATMAYRRVGGRETLPYETEPELPAAVAALQSQLQSQPALTVNIPEILSSVCSRMEQANALMHQT
SVESGVIDSNIWSFSALKVRITRVKLEQWAELVSAGADACSRESRGAETAHSSGQNNNHEPQTHARLDSETASGG
DLRADTGQWRGSYPQQNSDSELQFGSLAQDQTQIQNFLGGAPWTSDALDGIDPNVWLESYLDWGAVMMNTATGSA
EQ*
Coding >OphauG2|3879
ATGAAGACTGCTGCTCTTGCTTCGGCCCTCTTGGCCACCGTCGTTGCTGCCCAGCCGCGCGGCTACGCCATGCGC
CACAAGAATGTCGCTCGCGACATGGTGACGGAAACCGAGTGGGTTGTCGAGACGGCGTTTGTTACCGAAGTCATT
GATGCTTCAACCACCTTCATCATGCCTGCCGGTGCTACGCCCGACTCCGACTCCGACGGCACCTTTTTTGAACCG
CCCGCTGCTCCCGAACCCGAGGCCACGCCCGTCGAGGCTTCGCCTCCGCCGCCCTCAGCTGCTCCCCAGGCTCAG
GATAAGCCCGCTGGTGCTCCAGAGAAGCCTCAGCAACCCGTAGCTGGGCCGCCTGCTGCCCAGCAGCCTGTTGCT
CAGCCGCCGCCTCCACCGCAACAGCCCGTGGCCCAGCCGCCTCCGCCTCAGAACCCCCCGGCTCAGCAAGCTCCT
CCTGAGCGGCCCACTGCCCAGCCCATTCCTCAGCCCGCTCCTCAACCAACTCCCCAGCCGGCTCCTCAGCCAGCT
CCTCAGCCTGCTCCTCAGCCTGCTCCTCAGCCCCAGCTCGAGAGGCCTGCCTCCCCGTCGGCCATTGCCCCAAAC
TACAACTCTTTTGCCCTCCCCGGATGCATCTGCTGGCCTGTCCACGCCGACTCACCACCCCCGCCCGAGTCCGAC
GATGCCCTGCTCCAAACTTACCGCCGTGACATGCAACCTGTCCATCCCTTTGTCATAATCCCCCCCTCGTGCACC
GCGGCCGCCTTGGCCGCCAGCCGCCCGTTTCTCATGTCGGCCATCCGCATGGCTGCTTCGTTCCGCAATCTAAGA
TGCATGACGGCCCAGATGAGCCAGCTCATGCTTCATCTATCCGACTACATGCTGGTGCGCTCCCAGCGCTCCCTC
GACCTGCTGCAGGGCATTATTGTCATGCTGGGCTGGTACCAGTACCACTGCTTCCAGCATGCCCAGATGAACAAT
CTCATCGCCCTGGCTGTCAGCTTGGTCGGCGAGCTCGGTCTCAATCGCCCCCCCGTCTTGCGAGAGCAAGCCAGC
CTCATGGTTGCTCGTCCCGAGAAGCCTGCCGGCCGAACAAACGAAGAGCGGCGCGCCTGTGCAGCAGTGTGGTAC
CTCAATTCCGTAATGGCGACATCATTTGGAAGACTGGAGCCCATGCGCTACTCTGCCTATCTTCAGCAGTGCATC
AAGGAGCTTGAGGCGAGCCACGAGTATGAGACGGACGTTACACTCGTGTTTCTCCTTAGGTTACAGCACTTGACG
GATTGCATCCATGAGAACAACTGCCGAGACACAGCTGTAGATACTTTTCACGGCATCCCCACAGCCCCTGCATCC
GTATACGTGCAAGCCTTCCAGAGCGAACTGAATCGGTTAAGCAGTAAGCTGCCCGCACATCTCAAAGCGGATAAA
ACGATACAGATATTCCTCCACACGGCCTCGCTGCGGCTATACGAACCTCCAATCGCCGACTTGGCACACATTAAG
CAGCTCTCGGAATTGTTGACCACGGGCAGCATTGGAGCCGGCACGCCGCTTGACAAAATGTACCAGACAAATGCA
GCGCTCAGGGCCTGGTTCGACACATGGCTCTCCATCCCCGTTGCCACGTATTGCATCCAGCCTGCCGCGGTGGCC
GCTCAGTTCGTCTACGCCATTGTCATGCTTGGGCGCTGGGCCAAGCTGGCGACGCCCAGGACAATGTATCACGGC
GGCACGCCCATGCCAAGCACGGGCACGTCGAGCATGTCGGAATATGCAGCAGACCAACGGCCGGGGCCCTGTAGC
GCCGACAGGGCTGAATCATGGCCATGTCAGACGGCTACAATGGCGTATCGACGGGTCGGGGGTCGAGAGACATTG
CCCTACGAGACAGAGCCTGAGCTCCCGGCAGCAGTAGCAGCGCTGCAGTCTCAGCTGCAATCGCAGCCGGCCCTG
ACGGTCAACATACCCGAGATCCTATCCTCGGTCTGCAGCCGCATGGAGCAGGCAAACGCCTTGATGCACCAAACG
TCTGTCGAGTCGGGTGTGATTGACAGCAACATCTGGAGCTTTAGTGCGCTCAAGGTGCGCATCACGCGCGTCAAG
CTCGAGCAATGGGCCGAATTGGTGTCGGCAGGTGCAGACGCATGCAGCCGAGAAAGCCGCGGCGCAGAAACAGCC
CACAGCAGCGGGCAGAATAATAATCATGAGCCGCAGACCCATGCTCGCCTTGACAGCGAGACGGCAAGCGGTGGC
GACTTGAGGGCCGACACGGGCCAGTGGCGTGGCTCGTATCCCCAGCAAAACTCGGACTCGGAGCTGCAGTTTGGC
AGCCTGGCCCAGGACCAGACACAGATACAGAACTTCCTTGGCGGTGCGCCATGGACGTCGGATGCCCTTGATGGC
ATCGATCCCAACGTATGGCTCGAGAGCTACCTTGATTGGGGTGCCGTCATGATGAACACGGCGACTGGTAGCGCG
GAGCAGTAG
Transcript >OphauG2|3879
ATGAAGACTGCTGCTCTTGCTTCGGCCCTCTTGGCCACCGTCGTTGCTGCCCAGCCGCGCGGCTACGCCATGCGC
CACAAGAATGTCGCTCGCGACATGGTGACGGAAACCGAGTGGGTTGTCGAGACGGCGTTTGTTACCGAAGTCATT
GATGCTTCAACCACCTTCATCATGCCTGCCGGTGCTACGCCCGACTCCGACTCCGACGGCACCTTTTTTGAACCG
CCCGCTGCTCCCGAACCCGAGGCCACGCCCGTCGAGGCTTCGCCTCCGCCGCCCTCAGCTGCTCCCCAGGCTCAG
GATAAGCCCGCTGGTGCTCCAGAGAAGCCTCAGCAACCCGTAGCTGGGCCGCCTGCTGCCCAGCAGCCTGTTGCT
CAGCCGCCGCCTCCACCGCAACAGCCCGTGGCCCAGCCGCCTCCGCCTCAGAACCCCCCGGCTCAGCAAGCTCCT
CCTGAGCGGCCCACTGCCCAGCCCATTCCTCAGCCCGCTCCTCAACCAACTCCCCAGCCGGCTCCTCAGCCAGCT
CCTCAGCCTGCTCCTCAGCCTGCTCCTCAGCCCCAGCTCGAGAGGCCTGCCTCCCCGTCGGCCATTGCCCCAAAC
TACAACTCTTTTGCCCTCCCCGGATGCATCTGCTGGCCTGTCCACGCCGACTCACCACCCCCGCCCGAGTCCGAC
GATGCCCTGCTCCAAACTTACCGCCGTGACATGCAACCTGTCCATCCCTTTGTCATAATCCCCCCCTCGTGCACC
GCGGCCGCCTTGGCCGCCAGCCGCCCGTTTCTCATGTCGGCCATCCGCATGGCTGCTTCGTTCCGCAATCTAAGA
TGCATGACGGCCCAGATGAGCCAGCTCATGCTTCATCTATCCGACTACATGCTGGTGCGCTCCCAGCGCTCCCTC
GACCTGCTGCAGGGCATTATTGTCATGCTGGGCTGGTACCAGTACCACTGCTTCCAGCATGCCCAGATGAACAAT
CTCATCGCCCTGGCTGTCAGCTTGGTCGGCGAGCTCGGTCTCAATCGCCCCCCCGTCTTGCGAGAGCAAGCCAGC
CTCATGGTTGCTCGTCCCGAGAAGCCTGCCGGCCGAACAAACGAAGAGCGGCGCGCCTGTGCAGCAGTGTGGTAC
CTCAATTCCGTAATGGCGACATCATTTGGAAGACTGGAGCCCATGCGCTACTCTGCCTATCTTCAGCAGTGCATC
AAGGAGCTTGAGGCGAGCCACGAGTATGAGACGGACGTTACACTCGTGTTTCTCCTTAGGTTACAGCACTTGACG
GATTGCATCCATGAGAACAACTGCCGAGACACAGCTGTAGATACTTTTCACGGCATCCCCACAGCCCCTGCATCC
GTATACGTGCAAGCCTTCCAGAGCGAACTGAATCGGTTAAGCAGTAAGCTGCCCGCACATCTCAAAGCGGATAAA
ACGATACAGATATTCCTCCACACGGCCTCGCTGCGGCTATACGAACCTCCAATCGCCGACTTGGCACACATTAAG
CAGCTCTCGGAATTGTTGACCACGGGCAGCATTGGAGCCGGCACGCCGCTTGACAAAATGTACCAGACAAATGCA
GCGCTCAGGGCCTGGTTCGACACATGGCTCTCCATCCCCGTTGCCACGTATTGCATCCAGCCTGCCGCGGTGGCC
GCTCAGTTCGTCTACGCCATTGTCATGCTTGGGCGCTGGGCCAAGCTGGCGACGCCCAGGACAATGTATCACGGC
GGCACGCCCATGCCAAGCACGGGCACGTCGAGCATGTCGGAATATGCAGCAGACCAACGGCCGGGGCCCTGTAGC
GCCGACAGGGCTGAATCATGGCCATGTCAGACGGCTACAATGGCGTATCGACGGGTCGGGGGTCGAGAGACATTG
CCCTACGAGACAGAGCCTGAGCTCCCGGCAGCAGTAGCAGCGCTGCAGTCTCAGCTGCAATCGCAGCCGGCCCTG
ACGGTCAACATACCCGAGATCCTATCCTCGGTCTGCAGCCGCATGGAGCAGGCAAACGCCTTGATGCACCAAACG
TCTGTCGAGTCGGGTGTGATTGACAGCAACATCTGGAGCTTTAGTGCGCTCAAGGTGCGCATCACGCGCGTCAAG
CTCGAGCAATGGGCCGAATTGGTGTCGGCAGGTGCAGACGCATGCAGCCGAGAAAGCCGCGGCGCAGAAACAGCC
CACAGCAGCGGGCAGAATAATAATCATGAGCCGCAGACCCATGCTCGCCTTGACAGCGAGACGGCAAGCGGTGGC
GACTTGAGGGCCGACACGGGCCAGTGGCGTGGCTCGTATCCCCAGCAAAACTCGGACTCGGAGCTGCAGTTTGGC
AGCCTGGCCCAGGACCAGACACAGATACAGAACTTCCTTGGCGGTGCGCCATGGACGTCGGATGCCCTTGATGGC
ATCGATCCCAACGTATGGCTCGAGAGCTACCTTGATTGGGGTGCCGTCATGATGAACACGGCGACTGGTAGCGCG
GAGCAGTAG
Gene >OphauG2|3879
ATGAAGACTGCTGCTCTTGCTTCGGCCCTCTTGGCCACCGTCGTTGCTGCCCAGCCGCGCGGCTACGCCATGCGC
CACAAGAATGTCGCTCGCGACATGGTGACGGAAACCGAGTGGGTTGTCGAGACGGCGTTTGTTACCGAAGTCATT
GATGCTTCAACCACCTTCATCATGCCTGCCGGTGCTACGCCCGACTCCGACTCCGACGGCACCTTTTTTGAACCG
CCCGCTGCTCCCGAACCCGAGGCCACGCCCGTCGAGGCTTCGCCTCCGCCGCCCTCAGCTGCTCCCCAGGCTCAG
GATAAGCCCGCTGGTGCTCCAGAGAAGCCTCAGCAACCCGTAGCTGGGCCGCCTGCTGCCCAGCAGCCTGTTGCT
CAGCCGCCGCCTCCACCGCAACAGCCCGTGGCCCAGCCGCCTCCGCCTCAGAACCCCCCGGCTCAGCAAGCTCCT
CCTGAGCGGCCCACTGCCCAGCCCATTCCTCAGCCCGCTCCTCAACCAACTCCCCAGCCGGCTCCTCAGCCAGCT
CCTCAGCCTGCTCCTCAGCCTGCTCCTCAGCCCCAGCTCGAGAGGCCTGCCTCCCCGTCGGCCATTGCCCCAAAC
TACAACTCTTTTGCCCTCCCCGGATGCATCTGCTGGCCTGTCCACGCCGACTCACCACCCCCGCCCGAGTCCGAC
GATGCCCTGCTCCAAACTTACCGCCGTGACATGCAACCTGTCCATCCCTTTGTCATAATCCCCCCCTCGTGCACC
GCGGCCGCCTTGGCCGCCAGCCGCCCGTTTCTCATGTCGGCCATCCGCATGGCTGCTTCGTTCCGCAATCTAAGA
TGCATGACGGCCCAGATGAGCCAGCTCATGCTTCATCTATCCGACTACATGCTGGTGCGCTCCCAGCGCTCCCTC
GACCTGCTGCAGGGCATTATTGTCATGCTGGGCTGGTACCAGTACCACTGCTTCCAGCATGCCCAGATGAACAAT
CTCATCGCCCTGGCTGTCAGCTTGGTCGGCGAGCTCGGTCTCAATCGCCCCCCCGTCTTGCGAGAGCAAGCCAGC
CTCATGGTTGCTCGTCCCGAGAAGCCTGCCGGCCGAACAAACGAAGAGCGGCGCGCCTGTGCAGCAGTGTGGTAC
CTCAATTCCGTGTAGGTGCTTCTCCCCCTCGCCATGCGGCGCATTGTCGGCTGATGGCCCCTTTTCTAGAATGGC
GACATCATTTGGAAGACTGGAGCCCATGCGCTACTCTGCCTATCTTCAGCAGTGCATCAAGGAGCTTGAGGCGAG
CCACGAGTATGAGACGGACGTTACACTCGTGTTTCTCCTTAGGTTACAGCACTTGACGGATTGCATCCATGAGAA
CAACTGCCGAGACACAGCTGTAGATACTTTTCACGGCATCCCCACAGCCCCTGCATCCGTATACGTGCAAGCCTT
CCAGAGCGAACTGAATCGGTTAAGCAGTAAGCTGCCCGCACATCTCAAAGCGGATAGTAAGTCACGTCATGCCTG
CGGGCGTTGCATCGACGGCCCGCTGACTGGAGAGCGATTTGGACCAGAAACGATACAGATATTCCTCCACACGGC
CTCGCTGCGGCTATACGAACCTCCAATCGCCGACTTGGCACACATTAAGCAGCTCTCGGAATTGTTGACCACGGG
CAGCATTGGAGCCGGCACGCCGCTTGACAAAATGTACCAGACAAATGCAGCGCTCAGGGCCTGGTTCGACACATG
GCTCTCCATCCCCGTTGCCACGTATTGCATCCAGCCTGCCGCGGTGGCCGCTCAGTTCGTCTACGCCATTGTCAT
GCTTGGGCGCTGGGCCAAGCTGGCGACGCCCAGGACAATGTATCACGGCGGCACGCCCATGCCAAGCACGGGCAC
GTCGAGCATGTCGGAATATGCAGCAGACCAACGGCCGGGGCCCTGTAGCGCCGACAGGGCTGAATCATGGCCATG
TCAGACGGCTACAATGGCGTATCGACGGGTCGGGGGTCGAGAGACATTGCCCTACGAGACAGAGCCTGAGCTCCC
GGCAGCAGTAGCAGCGCTGCAGTCTCAGCTGCAATCGCAGCCGGCCCTGACGGTCAACATACCCGAGATCCTATC
CTCGGTCTGCAGCCGCATGGAGCAGGCAAACGCCTTGATGCACCAAACGTCTGTCGAGTCGGGTGTGATTGACAG
CAACATCTGGAGCTTTAGTGCGCTCAAGGTGCGCATCACGCGCGTCAAGCTCGAGCAATGGGCCGAATTGGTGTC
GGCAGGTGCAGACGCATGCAGCCGAGAAAGCCGCGGCGCAGAAACAGCCCACAGCAGCGGGCAGAATAATAATCA
TGAGCCGCAGACCCATGCTCGCCTTGACAGCGAGACGGCAAGCGGTGGCGACTTGAGGGCCGACACGGGCCAGTG
GCGTGGCTCGTATCCCCAGCAAAACTCGGACTCGGAGCTGCAGTTTGGCAGCCTGGCCCAGGACCAGACACAGAT
ACAGAACTTCCTTGGCGGTGCGCCATGGACGTCGGATGCCCTTGATGGCATCGATCCCAACGTATGGCTCGAGAG
CTACCTTGATTGGGGTGCCGTCATGATGAACACGGCGACTGGTAGCGCGGAGCAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail