Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|3876
Gene name
LocationContig_303:6634..7988
Strand-
Gene length (bp)1354
Transcript length (bp)1299
Coding sequence length (bp)1299
Protein length (aa) 433

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF15458 NTR2 Nineteen complex-related protein 2 6.7E-38 132 372

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0000390 spliceosomal complex disassembly Yes
GO:0071008 U2-type post-mRNA release spliceosomal complex Yes
GO:0071840 cellular component organization or biogenesis No
GO:0071014 post-mRNA release spliceosomal complex No
GO:0009987 cellular process No
GO:0022411 cellular component disassembly No
GO:0032984 protein-containing complex disassembly No
GO:1990904 ribonucleoprotein complex No
GO:0005575 cellular_component No
GO:0008150 biological_process No
GO:0032988 ribonucleoprotein complex disassembly No
GO:0043933 protein-containing complex organization No
GO:0140513 nuclear protein-containing complex No
GO:0032991 protein-containing complex No
GO:0071826 ribonucleoprotein complex subunit organization No
GO:0005681 spliceosomal complex No
GO:0016043 cellular component organization No
GO:0005684 U2-type spliceosomal complex No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4319
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3876 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|28
Ophiocordyceps camponoti-floridani Ophcf2|02703
Ophiocordyceps camponoti-rufipedis Ophun1|2732
Ophiocordyceps kimflemingae Ophio5|1839
Ophiocordyceps subramaniannii Hirsu2|8866

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|3876
MSSFSAKRRPRVIKVSEADDADAENSSASENDGTRQEALKPLFGFKAGRKPFRQSGLRKSFTPADQSTTEQGQEA
NSTQDDACVVIRPNAMKQKKKMAKSKHSFGLGAGDARAGIAIRELPPLVAREDPDRPIYSKEHLSELQSSTPNTP
PEILSGPTDVDEMMLDASELQGATIVDASEVMTSVPNTKIPSEAEIRERKERRARLANEQESIVIDDDGENGMGR
GKKEATRLVREEEDLGEGFDDYVEDGGLALGKRAEKEQRRRHRRQMAKLINAAEGHSSESSSESDAERRMAYEAT
QTRAGLDGMEKSRKSTEDKSVQLPDKFPPLPSLSECLTRLQASLKKMEKDVKAKHASIEQLRREREEVDRREAEL
QALLDETGRKYQEAMSHGALSGVQGAVTGSNGEFATQRGLESIGATPVRPDDDVDMS*
Coding >OphauG2|3876
ATGAGCTCCTTTTCCGCAAAGCGCCGACCGCGCGTCATCAAAGTCTCAGAGGCCGACGATGCAGATGCCGAGAAT
TCGTCAGCTTCAGAAAACGATGGCACCAGACAAGAAGCCCTCAAGCCGCTCTTTGGCTTCAAGGCGGGACGCAAA
CCTTTTCGACAGTCCGGGCTGCGAAAGAGCTTCACTCCTGCCGACCAGAGTACTACCGAACAAGGCCAGGAGGCA
AACTCAACCCAAGACGATGCATGTGTCGTCATCCGACCCAATGCAATGAAGCAAAAGAAGAAAATGGCTAAATCG
AAGCATTCATTTGGCTTGGGAGCTGGAGATGCAAGGGCTGGCATTGCTATACGGGAACTGCCACCGCTGGTGGCT
CGAGAGGACCCGGATAGACCGATATATAGTAAGGAGCATCTCAGTGAGCTCCAGTCTTCGACACCCAACACACCG
CCCGAGATATTATCCGGGCCTACGGACGTGGATGAAATGATGCTGGACGCGTCTGAACTCCAAGGCGCAACGATT
GTTGATGCCTCCGAGGTAATGACTTCAGTGCCCAATACCAAGATTCCATCCGAGGCCGAAATTCGTGAGAGAAAG
GAACGACGCGCGCGCTTGGCAAACGAACAAGAATCCATCGTCATTGATGACGATGGTGAGAATGGGATGGGACGA
GGCAAAAAGGAGGCAACCAGGCTAGTCCGTGAAGAGGAAGATCTTGGCGAGGGATTTGACGACTATGTCGAGGAC
GGAGGTCTGGCTCTAGGAAAGCGTGCAGAAAAAGAGCAGCGAAGGCGTCATCGACGACAAATGGCTAAGCTCATC
AACGCAGCCGAAGGCCACTCGTCCGAGTCGTCATCAGAAAGCGATGCTGAGCGCCGCATGGCGTACGAGGCAACG
CAAACAAGGGCAGGGCTCGACGGCATGGAAAAGTCTAGAAAGAGCACAGAGGACAAAAGCGTGCAGTTACCTGAC
AAGTTTCCGCCCTTGCCTAGCCTGTCCGAGTGCTTGACACGGCTGCAGGCCAGTCTGAAAAAGATGGAAAAAGAC
GTCAAGGCCAAACATGCAAGCATTGAGCAGCTTAGACGCGAGAGAGAAGAGGTGGATAGAAGGGAGGCAGAACTT
CAGGCGCTCCTTGACGAAACGGGGAGAAAGTACCAGGAAGCAATGAGCCATGGTGCGTTGAGTGGTGTGCAAGGC
GCAGTCACGGGCTCCAACGGCGAGTTTGCTACACAACGAGGACTTGAGAGCATTGGAGCCACTCCGGTAAGGCCA
GACGACGACGTGGACATGTCCTAG
Transcript >OphauG2|3876
ATGAGCTCCTTTTCCGCAAAGCGCCGACCGCGCGTCATCAAAGTCTCAGAGGCCGACGATGCAGATGCCGAGAAT
TCGTCAGCTTCAGAAAACGATGGCACCAGACAAGAAGCCCTCAAGCCGCTCTTTGGCTTCAAGGCGGGACGCAAA
CCTTTTCGACAGTCCGGGCTGCGAAAGAGCTTCACTCCTGCCGACCAGAGTACTACCGAACAAGGCCAGGAGGCA
AACTCAACCCAAGACGATGCATGTGTCGTCATCCGACCCAATGCAATGAAGCAAAAGAAGAAAATGGCTAAATCG
AAGCATTCATTTGGCTTGGGAGCTGGAGATGCAAGGGCTGGCATTGCTATACGGGAACTGCCACCGCTGGTGGCT
CGAGAGGACCCGGATAGACCGATATATAGTAAGGAGCATCTCAGTGAGCTCCAGTCTTCGACACCCAACACACCG
CCCGAGATATTATCCGGGCCTACGGACGTGGATGAAATGATGCTGGACGCGTCTGAACTCCAAGGCGCAACGATT
GTTGATGCCTCCGAGGTAATGACTTCAGTGCCCAATACCAAGATTCCATCCGAGGCCGAAATTCGTGAGAGAAAG
GAACGACGCGCGCGCTTGGCAAACGAACAAGAATCCATCGTCATTGATGACGATGGTGAGAATGGGATGGGACGA
GGCAAAAAGGAGGCAACCAGGCTAGTCCGTGAAGAGGAAGATCTTGGCGAGGGATTTGACGACTATGTCGAGGAC
GGAGGTCTGGCTCTAGGAAAGCGTGCAGAAAAAGAGCAGCGAAGGCGTCATCGACGACAAATGGCTAAGCTCATC
AACGCAGCCGAAGGCCACTCGTCCGAGTCGTCATCAGAAAGCGATGCTGAGCGCCGCATGGCGTACGAGGCAACG
CAAACAAGGGCAGGGCTCGACGGCATGGAAAAGTCTAGAAAGAGCACAGAGGACAAAAGCGTGCAGTTACCTGAC
AAGTTTCCGCCCTTGCCTAGCCTGTCCGAGTGCTTGACACGGCTGCAGGCCAGTCTGAAAAAGATGGAAAAAGAC
GTCAAGGCCAAACATGCAAGCATTGAGCAGCTTAGACGCGAGAGAGAAGAGGTGGATAGAAGGGAGGCAGAACTT
CAGGCGCTCCTTGACGAAACGGGGAGAAAGTACCAGGAAGCAATGAGCCATGGTGCGTTGAGTGGTGTGCAAGGC
GCAGTCACGGGCTCCAACGGCGAGTTTGCTACACAACGAGGACTTGAGAGCATTGGAGCCACTCCGGTAAGGCCA
GACGACGACGTGGACATGTCCTAG
Gene >OphauG2|3876
ATGAGCTCCTTTTCCGCAAAGCGCCGACCGCGCGTCATCAAAGTCTCAGAGGCCGACGATGCAGATGCCGAGAAT
TCGTCAGCTTCAGAAAACGATGGCACCAGACAAGGTAGGATGCGCCTCCTCTGGCACCCTGTTTCCATTGCTGAC
CAAGAACGAGTCAGAAGCCCTCAAGCCGCTCTTTGGCTTCAAGGCGGGACGCAAACCTTTTCGACAGTCCGGGCT
GCGAAAGAGCTTCACTCCTGCCGACCAGAGTACTACCGAACAAGGCCAGGAGGCAAACTCAACCCAAGACGATGC
ATGTGTCGTCATCCGACCCAATGCAATGAAGCAAAAGAAGAAAATGGCTAAATCGAAGCATTCATTTGGCTTGGG
AGCTGGAGATGCAAGGGCTGGCATTGCTATACGGGAACTGCCACCGCTGGTGGCTCGAGAGGACCCGGATAGACC
GATATATAGTAAGGAGCATCTCAGTGAGCTCCAGTCTTCGACACCCAACACACCGCCCGAGATATTATCCGGGCC
TACGGACGTGGATGAAATGATGCTGGACGCGTCTGAACTCCAAGGCGCAACGATTGTTGATGCCTCCGAGGTAAT
GACTTCAGTGCCCAATACCAAGATTCCATCCGAGGCCGAAATTCGTGAGAGAAAGGAACGACGCGCGCGCTTGGC
AAACGAACAAGAATCCATCGTCATTGATGACGATGGTGAGAATGGGATGGGACGAGGCAAAAAGGAGGCAACCAG
GCTAGTCCGTGAAGAGGAAGATCTTGGCGAGGGATTTGACGACTATGTCGAGGACGGAGGTCTGGCTCTAGGAAA
GCGTGCAGAAAAAGAGCAGCGAAGGCGTCATCGACGACAAATGGCTAAGCTCATCAACGCAGCCGAAGGCCACTC
GTCCGAGTCGTCATCAGAAAGCGATGCTGAGCGCCGCATGGCGTACGAGGCAACGCAAACAAGGGCAGGGCTCGA
CGGCATGGAAAAGTCTAGAAAGAGCACAGAGGACAAAAGCGTGCAGTTACCTGACAAGTTTCCGCCCTTGCCTAG
CCTGTCCGAGTGCTTGACACGGCTGCAGGCCAGTCTGAAAAAGATGGAAAAAGACGTCAAGGCCAAACATGCAAG
CATTGAGCAGCTTAGACGCGAGAGAGAAGAGGTGGATAGAAGGGAGGCAGAACTTCAGGCGCTCCTTGACGAAAC
GGGGAGAAAGTACCAGGAAGCAATGAGCCATGGTGCGTTGAGTGGTGTGCAAGGCGCAGTCACGGGCTCCAACGG
CGAGTTTGCTACACAACGAGGACTTGAGAGCATTGGAGCCACTCCGGTAAGGCCAGACGACGACGTGGACATGTC
CTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail