Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|3875
Gene name
LocationContig_303:4119..6058
Strand-
Gene length (bp)1939
Transcript length (bp)1731
Coding sequence length (bp)1731
Protein length (aa) 577

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF17830 STI1 STI1 domain 8.0E-22 140 194
PF17830 STI1 STI1 domain 2.9E-15 517 567
PF07719 TPR_2 Tetratricopeptide repeat 6.1E-05 285 311
PF13181 TPR_8 Tetratricopeptide repeat 2.5E-03 285 311
PF13181 TPR_8 Tetratricopeptide repeat 1.4E-04 325 351
PF13432 TPR_16 Tetratricopeptide repeat 3.5E-04 9 61
PF13424 TPR_12 Tetratricopeptide repeat 1.8E-08 286 351
PF13176 TPR_7 Tetratricopeptide repeat 4.7E-03 326 357

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9USI5|STI1_SCHPO Heat shock protein sti1 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sti1 PE=3 SV=1 4 575 0.0E+00
sp|P15705|STI1_YEAST Heat shock protein STI1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STI1 PE=1 SV=1 3 576 0.0E+00
sp|Q3ZBZ8|STIP1_BOVIN Stress-induced-phosphoprotein 1 OS=Bos taurus GN=STIP1 PE=2 SV=1 1 574 8.0E-141
sp|Q4R8N7|STIP1_MACFA Stress-induced-phosphoprotein 1 OS=Macaca fascicularis GN=STIP1 PE=2 SV=1 1 574 3.0E-140
sp|P31948|STIP1_HUMAN Stress-induced-phosphoprotein 1 OS=Homo sapiens GN=STIP1 PE=1 SV=1 1 574 8.0E-139
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9USI5|STI1_SCHPO Heat shock protein sti1 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sti1 PE=3 SV=1 4 575 0.0E+00
sp|P15705|STI1_YEAST Heat shock protein STI1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STI1 PE=1 SV=1 3 576 0.0E+00
sp|Q3ZBZ8|STIP1_BOVIN Stress-induced-phosphoprotein 1 OS=Bos taurus GN=STIP1 PE=2 SV=1 1 574 8.0E-141
sp|Q4R8N7|STIP1_MACFA Stress-induced-phosphoprotein 1 OS=Macaca fascicularis GN=STIP1 PE=2 SV=1 1 574 3.0E-140
sp|P31948|STIP1_HUMAN Stress-induced-phosphoprotein 1 OS=Homo sapiens GN=STIP1 PE=1 SV=1 1 574 8.0E-139
sp|O54981|STIP1_CRIGR Stress-induced-phosphoprotein 1 OS=Cricetulus griseus GN=STIP1 PE=2 SV=1 1 574 1.0E-138
sp|O35814|STIP1_RAT Stress-induced-phosphoprotein 1 OS=Rattus norvegicus GN=Stip1 PE=1 SV=1 1 574 2.0E-138
sp|Q60864|STIP1_MOUSE Stress-induced-phosphoprotein 1 OS=Mus musculus GN=Stip1 PE=1 SV=1 1 574 2.0E-138
sp|Q9STH1|HSOP3_ARATH Hsp70-Hsp90 organizing protein 3 OS=Arabidopsis thaliana GN=HOP3 PE=2 SV=1 4 574 1.0E-133
sp|F8RP11|HSOP_WHEAT Hsp70-Hsp90 organizing protein OS=Triticum aestivum GN=HOP PE=1 SV=1 4 574 7.0E-132
sp|Q5XEP2|HSOP2_ARATH Hsp70-Hsp90 organizing protein 2 OS=Arabidopsis thaliana GN=HOP2 PE=1 SV=1 4 574 2.0E-126
sp|Q9LNB6|HSOP1_ARATH Hsp70-Hsp90 organizing protein 1 OS=Arabidopsis thaliana GN=HOP1 PE=2 SV=1 4 574 5.0E-125
sp|Q43468|HSOP1_SOYBN Hsp70-Hsp90 organizing protein 1 OS=Glycine max GN=HOP1 PE=1 SV=2 4 574 4.0E-119
sp|Q54DA8|STIP1_DICDI Protein STIP1 homolog OS=Dictyostelium discoideum GN=sti1 PE=3 SV=1 4 575 5.0E-103
sp|Q8ILC1|STI1L_PLAF7 STI1-like protein OS=Plasmodium falciparum (isolate 3D7) GN=PF14_0324 PE=3 SV=1 4 574 9.0E-85
sp|O16259|STIP1_CAEEL Stress-induced-phosphoprotein 1 OS=Caenorhabditis elegans GN=sti-1 PE=1 SV=1 254 574 3.0E-73
sp|P25407|STI1L_PLAFA STI1-like protein (Fragment) OS=Plasmodium falciparum PE=4 SV=1 4 181 2.0E-20
sp|Q80W98|SGTB_RAT Small glutamine-rich tetratricopeptide repeat-containing protein beta OS=Rattus norvegicus GN=Sgtb PE=1 SV=1 4 158 2.0E-18
sp|Q12118|SGT2_YEAST Small glutamine-rich tetratricopeptide repeat-containing protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SGT2 PE=1 SV=1 2 194 6.0E-18
sp|Q8VD33|SGTB_MOUSE Small glutamine-rich tetratricopeptide repeat-containing protein beta OS=Mus musculus GN=Sgtb PE=1 SV=1 4 158 6.0E-18
sp|Q96EQ0|SGTB_HUMAN Small glutamine-rich tetratricopeptide repeat-containing protein beta OS=Homo sapiens GN=SGTB PE=1 SV=1 4 158 2.0E-17
sp|P0CT30|SGT2_USTMA Small glutamine-rich tetratricopeptide repeat-containing protein 2 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=UMAG_10205 PE=3 SV=1 1 188 2.0E-17
sp|P0CT30|SGT2_USTMA Small glutamine-rich tetratricopeptide repeat-containing protein 2 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=UMAG_10205 PE=3 SV=1 380 570 6.0E-16
sp|Q32LM2|SGTA_BOVIN Small glutamine-rich tetratricopeptide repeat-containing protein alpha OS=Bos taurus GN=SGTA PE=2 SV=1 2 181 8.0E-15
sp|O13797|SGT2_SCHPO Small glutamine-rich tetratricopeptide repeat-containing protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sgt2 PE=3 SV=1 4 170 9.0E-15
sp|Q5U2X2|SPAG1_RAT Sperm-associated antigen 1 OS=Rattus norvegicus GN=Spag1 PE=1 SV=1 4 472 1.0E-14
sp|O43765|SGTA_HUMAN Small glutamine-rich tetratricopeptide repeat-containing protein alpha OS=Homo sapiens GN=SGTA PE=1 SV=1 2 174 5.0E-14
sp|Q96AY4|TTC28_HUMAN Tetratricopeptide repeat protein 28 OS=Homo sapiens GN=TTC28 PE=1 SV=4 12 120 9.0E-14
sp|Q80XJ3|TTC28_MOUSE Tetratricopeptide repeat protein 28 OS=Mus musculus GN=Ttc28 PE=1 SV=3 12 120 2.0E-13
sp|F1RBN2|SPAG1_DANRE Sperm-associated antigen 1A OS=Danio rerio GN=spag1a PE=2 SV=1 252 481 5.0E-13
sp|O95801|TTC4_HUMAN Tetratricopeptide repeat protein 4 OS=Homo sapiens GN=TTC4 PE=1 SV=3 382 492 1.0E-12
sp|Q8BJU0|SGTA_MOUSE Small glutamine-rich tetratricopeptide repeat-containing protein alpha OS=Mus musculus GN=Sgta PE=1 SV=2 2 174 1.0E-12
sp|O16259|STIP1_CAEEL Stress-induced-phosphoprotein 1 OS=Caenorhabditis elegans GN=sti-1 PE=1 SV=1 4 202 2.0E-12
sp|O70593|SGTA_RAT Small glutamine-rich tetratricopeptide repeat-containing protein alpha OS=Rattus norvegicus GN=Sgta PE=1 SV=1 2 174 2.0E-12
sp|Q5EA11|TTC4_BOVIN Tetratricopeptide repeat protein 4 OS=Bos taurus GN=TTC4 PE=2 SV=2 382 492 2.0E-12
sp|Q84K11|PPP5_SOLLC Serine/threonine-protein phosphatase 5 OS=Solanum lycopersicum GN=PP5 PE=1 SV=1 4 121 4.0E-12
sp|Q80W98|SGTB_RAT Small glutamine-rich tetratricopeptide repeat-containing protein beta OS=Rattus norvegicus GN=Sgtb PE=1 SV=1 380 539 6.0E-12
sp|Q8VD33|SGTB_MOUSE Small glutamine-rich tetratricopeptide repeat-containing protein beta OS=Mus musculus GN=Sgtb PE=1 SV=1 380 539 6.0E-12
sp|Q9LVH5|OE64C_ARATH Outer envelope protein 64, chloroplastic OS=Arabidopsis thaliana GN=OEP64 PE=1 SV=1 373 461 1.0E-11
sp|Q12118|SGT2_YEAST Small glutamine-rich tetratricopeptide repeat-containing protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SGT2 PE=1 SV=1 355 570 2.0E-11
sp|Q96EQ0|SGTB_HUMAN Small glutamine-rich tetratricopeptide repeat-containing protein beta OS=Homo sapiens GN=SGTB PE=1 SV=1 380 539 2.0E-11
sp|Q9CYG7|TOM34_MOUSE Mitochondrial import receptor subunit TOM34 OS=Mus musculus GN=Tomm34 PE=1 SV=1 245 468 2.0E-11
sp|Q5ZKQ3|RPAP3_CHICK RNA polymerase II-associated protein 3 OS=Gallus gallus GN=RPAP3 PE=2 SV=1 378 524 3.0E-11
sp|Q54IP0|DNJC7_DICDI DnaJ homolog subfamily C member 7 homolog OS=Dictyostelium discoideum GN=dnajc7 PE=1 SV=1 327 485 3.0E-11
sp|Q8R3H9|TTC4_MOUSE Tetratricopeptide repeat protein 4 OS=Mus musculus GN=Ttc4 PE=1 SV=1 382 492 6.0E-11
sp|Q5ZKQ3|RPAP3_CHICK RNA polymerase II-associated protein 3 OS=Gallus gallus GN=RPAP3 PE=2 SV=1 11 124 7.0E-11
sp|Q93YR3|F10AL_ARATH FAM10 family protein At4g22670 OS=Arabidopsis thaliana GN=At4g22670 PE=1 SV=1 3 81 3.0E-10
sp|Q3KRD5|TOM34_RAT Mitochondrial import receptor subunit TOM34 OS=Rattus norvegicus GN=Tomm34 PE=1 SV=1 245 482 4.0E-10
sp|Q32LM2|SGTA_BOVIN Small glutamine-rich tetratricopeptide repeat-containing protein alpha OS=Bos taurus GN=SGTA PE=2 SV=1 380 570 5.0E-10
sp|P53041|PPP5_HUMAN Serine/threonine-protein phosphatase 5 OS=Homo sapiens GN=PPP5C PE=1 SV=1 1 192 6.0E-10
sp|Q28IV3|RPAP3_XENTR RNA polymerase II-associated protein 3 OS=Xenopus tropicalis GN=rpap3 PE=2 SV=1 11 120 6.0E-10
sp|O43765|SGTA_HUMAN Small glutamine-rich tetratricopeptide repeat-containing protein alpha OS=Homo sapiens GN=SGTA PE=1 SV=1 380 570 1.0E-09
sp|O70593|SGTA_RAT Small glutamine-rich tetratricopeptide repeat-containing protein alpha OS=Rattus norvegicus GN=Sgta PE=1 SV=1 380 482 1.0E-09
sp|P53042|PPP5_RAT Serine/threonine-protein phosphatase 5 OS=Rattus norvegicus GN=Ppp5c PE=1 SV=1 1 192 1.0E-09
sp|Q99615|DNJC7_HUMAN DnaJ homolog subfamily C member 7 OS=Homo sapiens GN=DNAJC7 PE=1 SV=2 388 526 1.0E-09
sp|Q60676|PPP5_MOUSE Serine/threonine-protein phosphatase 5 OS=Mus musculus GN=Ppp5c PE=1 SV=3 1 192 1.0E-09
sp|Q8BJU0|SGTA_MOUSE Small glutamine-rich tetratricopeptide repeat-containing protein alpha OS=Mus musculus GN=Sgta PE=1 SV=2 380 482 2.0E-09
sp|Q6NU95|RPAP3_XENLA RNA polymerase II-associated protein 3 OS=Xenopus laevis GN=rpap3 PE=2 SV=1 11 124 2.0E-09
sp|Q9QYI3|DNJC7_MOUSE DnaJ homolog subfamily C member 7 OS=Mus musculus GN=Dnajc7 PE=1 SV=2 388 526 2.0E-09
sp|Q54DA8|STIP1_DICDI Protein STIP1 homolog OS=Dictyostelium discoideum GN=sti1 PE=3 SV=1 382 571 3.0E-09
sp|Q5R8D8|DNJC7_PONAB DnaJ homolog subfamily C member 7 OS=Pongo abelii GN=DNAJC7 PE=2 SV=1 388 526 5.0E-09
sp|A4K2V0|TOM34_PONAB Mitochondrial import receptor subunit TOM34 OS=Pongo abelii GN=TOMM34 PE=2 SV=1 250 468 6.0E-09
sp|Q9H6T3|RPAP3_HUMAN RNA polymerase II-associated protein 3 OS=Homo sapiens GN=RPAP3 PE=1 SV=2 378 471 6.0E-09
sp|O43049|PPT1_SCHPO Serine/threonine-protein phosphatase T OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppt1 PE=3 SV=2 4 81 7.0E-09
sp|Q15785|TOM34_HUMAN Mitochondrial import receptor subunit TOM34 OS=Homo sapiens GN=TOMM34 PE=1 SV=2 248 468 7.0E-09
sp|Q68FQ7|RPAP3_RAT RNA polymerase II-associated protein 3 OS=Rattus norvegicus GN=Rpap3 PE=1 SV=1 379 496 9.0E-09
sp|Q9D706|RPAP3_MOUSE RNA polymerase II-associated protein 3 OS=Mus musculus GN=Rpap3 PE=1 SV=1 379 496 1.0E-08
sp|Q84XU2|PPP5_ARATH Serine/threonine-protein phosphatase 5 OS=Arabidopsis thaliana GN=PAPP5 PE=1 SV=1 1 121 1.0E-08
sp|Q9D4H7|LONF3_MOUSE LON peptidase N-terminal domain and RING finger protein 3 OS=Mus musculus GN=Lonrf3 PE=2 SV=1 376 470 1.0E-08
sp|Q496Y0|LONF3_HUMAN LON peptidase N-terminal domain and RING finger protein 3 OS=Homo sapiens GN=LONRF3 PE=1 SV=1 376 470 1.0E-08
sp|Q99615|DNJC7_HUMAN DnaJ homolog subfamily C member 7 OS=Homo sapiens GN=DNAJC7 PE=1 SV=2 4 122 2.0E-08
sp|Q9QYI3|DNJC7_MOUSE DnaJ homolog subfamily C member 7 OS=Mus musculus GN=Dnajc7 PE=1 SV=2 4 122 2.0E-08
sp|Q5R8D8|DNJC7_PONAB DnaJ homolog subfamily C member 7 OS=Pongo abelii GN=DNAJC7 PE=2 SV=1 4 122 2.0E-08
sp|Q54VG4|SGT_DICDI Small glutamine-rich tetratricopeptide repeat-containing protein OS=Dictyostelium discoideum GN=sgt PE=1 SV=1 2 192 2.0E-08
sp|P53804|TTC3_HUMAN E3 ubiquitin-protein ligase TTC3 OS=Homo sapiens GN=TTC3 PE=1 SV=2 7 171 2.0E-08
sp|P53043|PPT1_YEAST Serine/threonine-protein phosphatase T OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PPT1 PE=1 SV=1 380 468 2.0E-08
sp|Q5ZKQ3|RPAP3_CHICK RNA polymerase II-associated protein 3 OS=Gallus gallus GN=RPAP3 PE=2 SV=1 229 472 3.0E-08
sp|Q9H6T3|RPAP3_HUMAN RNA polymerase II-associated protein 3 OS=Homo sapiens GN=RPAP3 PE=1 SV=2 7 119 3.0E-08
sp|Q9D4H7|LONF3_MOUSE LON peptidase N-terminal domain and RING finger protein 3 OS=Mus musculus GN=Lonrf3 PE=2 SV=1 2 110 3.0E-08
sp|Q91Z38|TTC1_MOUSE Tetratricopeptide repeat protein 1 OS=Mus musculus GN=Ttc1 PE=1 SV=1 388 500 3.0E-08
sp|Q99614|TTC1_HUMAN Tetratricopeptide repeat protein 1 OS=Homo sapiens GN=TTC1 PE=1 SV=1 382 473 3.0E-08
sp|Q9MUK5|TOC64_PEA Translocon at the outer membrane of chloroplasts 64 OS=Pisum sativum GN=TOC64 PE=1 SV=1 382 493 4.0E-08
sp|Q8BW49|TTC12_MOUSE Tetratricopeptide repeat protein 12 OS=Mus musculus GN=Ttc12 PE=1 SV=1 356 471 5.0E-08
sp|P25407|STI1L_PLAFA STI1-like protein (Fragment) OS=Plasmodium falciparum PE=4 SV=1 379 482 6.0E-08
sp|Q75Q39|TOM70_RAT Mitochondrial import receptor subunit TOM70 OS=Rattus norvegicus GN=Tomm70a PE=1 SV=1 382 476 6.0E-08
sp|Q496Y0|LONF3_HUMAN LON peptidase N-terminal domain and RING finger protein 3 OS=Homo sapiens GN=LONRF3 PE=1 SV=1 2 130 7.0E-08
sp|P25638|TAH1_YEAST TPR repeat-containing protein associated with Hsp90 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TAH1 PE=1 SV=1 385 446 8.0E-08
sp|P38825|TOM71_YEAST Protein TOM71 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TOM71 PE=1 SV=1 2 91 8.0E-08
sp|O94826|TOM70_HUMAN Mitochondrial import receptor subunit TOM70 OS=Homo sapiens GN=TOMM70A PE=1 SV=1 382 476 8.0E-08
sp|Q54VG4|SGT_DICDI Small glutamine-rich tetratricopeptide repeat-containing protein OS=Dictyostelium discoideum GN=sgt PE=1 SV=1 384 482 9.0E-08
sp|P23231|TOM70_NEUCR Mitochondrial import receptor subunit tom70 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=tom70 PE=2 SV=3 2 81 9.0E-08
sp|Q8BJU0|SGTA_MOUSE Small glutamine-rich tetratricopeptide repeat-containing protein alpha OS=Mus musculus GN=Sgta PE=1 SV=2 186 351 1.0E-07
sp|O70593|SGTA_RAT Small glutamine-rich tetratricopeptide repeat-containing protein alpha OS=Rattus norvegicus GN=Sgta PE=1 SV=1 186 351 1.0E-07
sp|Q84K11|PPP5_SOLLC Serine/threonine-protein phosphatase 5 OS=Solanum lycopersicum GN=PP5 PE=1 SV=1 383 481 1.0E-07
sp|Q9D706|RPAP3_MOUSE RNA polymerase II-associated protein 3 OS=Mus musculus GN=Rpap3 PE=1 SV=1 7 127 1.0E-07
sp|P23231|TOM70_NEUCR Mitochondrial import receptor subunit tom70 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=tom70 PE=2 SV=3 375 482 1.0E-07
sp|Q9CZW5|TOM70_MOUSE Mitochondrial import receptor subunit TOM70 OS=Mus musculus GN=Tomm70a PE=1 SV=2 382 476 1.0E-07
sp|F4KCL7|OE64M_ARATH Outer envelope protein 64, mitochondrial OS=Arabidopsis thaliana GN=OM64 PE=1 SV=1 356 470 1.0E-07
sp|O88196|TTC3_MOUSE E3 ubiquitin-protein ligase TTC3 OS=Mus musculus GN=Ttc3 PE=1 SV=2 7 87 1.0E-07
sp|Q49AM3|TTC31_HUMAN Tetratricopeptide repeat protein 31 OS=Homo sapiens GN=TTC31 PE=2 SV=3 1 84 1.0E-07
sp|Q9H892|TTC12_HUMAN Tetratricopeptide repeat protein 12 OS=Homo sapiens GN=TTC12 PE=1 SV=2 384 471 2.0E-07
sp|P33313|CNS1_YEAST Hsp70/Hsp90 co-chaperone CNS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CNS1 PE=1 SV=1 382 522 2.0E-07
sp|Q3ZBR5|TTC1_BOVIN Tetratricopeptide repeat protein 1 OS=Bos taurus GN=TTC1 PE=2 SV=1 382 473 2.0E-07
sp|O13797|SGT2_SCHPO Small glutamine-rich tetratricopeptide repeat-containing protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sgt2 PE=3 SV=1 377 465 3.0E-07
sp|Q5ZKQ3|RPAP3_CHICK RNA polymerase II-associated protein 3 OS=Gallus gallus GN=RPAP3 PE=2 SV=1 8 119 3.0E-07
sp|Q9SIN1|TTL3_ARATH Inactive TPR repeat-containing thioredoxin TTL3 OS=Arabidopsis thaliana GN=TTL3 PE=1 SV=2 387 472 3.0E-07
sp|Q9UNE7|CHIP_HUMAN E3 ubiquitin-protein ligase CHIP OS=Homo sapiens GN=STUB1 PE=1 SV=2 381 472 4.0E-07
sp|Q5ZHY5|CHIP_CHICK STIP1 homology and U box-containing protein 1 OS=Gallus gallus GN=STUB1 PE=2 SV=1 381 472 4.0E-07
sp|Q80ZX8|SPAG1_MOUSE Sperm-associated antigen 1 OS=Mus musculus GN=Spag1 PE=1 SV=1 391 482 4.0E-07
sp|Q32LM2|SGTA_BOVIN Small glutamine-rich tetratricopeptide repeat-containing protein alpha OS=Bos taurus GN=SGTA PE=2 SV=1 249 351 5.0E-07
sp|Q6NU95|RPAP3_XENLA RNA polymerase II-associated protein 3 OS=Xenopus laevis GN=rpap3 PE=2 SV=1 379 511 5.0E-07
sp|O14217|TOM70_SCHPO Probable mitochondrial import receptor subunit tom70 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tom70 PE=1 SV=1 4 88 5.0E-07
sp|Q8ILC1|STI1L_PLAF7 STI1-like protein OS=Plasmodium falciparum (isolate 3D7) GN=PF14_0324 PE=3 SV=1 379 482 6.0E-07
sp|Q54IP0|DNJC7_DICDI DnaJ homolog subfamily C member 7 homolog OS=Dictyostelium discoideum GN=dnajc7 PE=1 SV=1 1 112 6.0E-07
sp|Q95LY5|TTC12_MACFA Tetratricopeptide repeat protein 12 (Fragment) OS=Macaca fascicularis GN=TTC12 PE=2 SV=1 384 471 6.0E-07
sp|Q8IZP2|ST134_HUMAN Putative protein FAM10A4 OS=Homo sapiens GN=ST13P4 PE=5 SV=1 1 81 7.0E-07
sp|Q5U2X2|SPAG1_RAT Sperm-associated antigen 1 OS=Rattus norvegicus GN=Spag1 PE=1 SV=1 391 473 8.0E-07
sp|Q6ES52|TDX_ORYSJ TPR repeat-containing thioredoxin TDX OS=Oryza sativa subsp. japonica GN=Os09g0401200 PE=2 SV=1 11 81 8.0E-07
sp|O43765|SGTA_HUMAN Small glutamine-rich tetratricopeptide repeat-containing protein alpha OS=Homo sapiens GN=SGTA PE=1 SV=1 249 351 9.0E-07
sp|Q8N5D0|WDTC1_HUMAN WD and tetratricopeptide repeats protein 1 OS=Homo sapiens GN=WDTC1 PE=1 SV=2 381 473 9.0E-07
sp|Q6NU95|RPAP3_XENLA RNA polymerase II-associated protein 3 OS=Xenopus laevis GN=rpap3 PE=2 SV=1 226 470 1.0E-06
sp|Q84XU2|PPP5_ARATH Serine/threonine-protein phosphatase 5 OS=Arabidopsis thaliana GN=PAPP5 PE=1 SV=1 380 481 1.0E-06
sp|Q8VWG7|TDX_ARATH TPR repeat-containing thioredoxin TDX OS=Arabidopsis thaliana GN=TDX PE=1 SV=1 8 81 1.0E-06
sp|F4IXE4|TTL2_ARATH TPR repeat-containing thioredoxin TTL2 OS=Arabidopsis thaliana GN=TTL2 PE=2 SV=2 385 492 1.0E-06
sp|Q28IV3|RPAP3_XENTR RNA polymerase II-associated protein 3 OS=Xenopus tropicalis GN=rpap3 PE=2 SV=1 257 470 2.0E-06
sp|Q68FQ7|RPAP3_RAT RNA polymerase II-associated protein 3 OS=Rattus norvegicus GN=Rpap3 PE=1 SV=1 7 119 2.0E-06
sp|Q68FQ7|RPAP3_RAT RNA polymerase II-associated protein 3 OS=Rattus norvegicus GN=Rpap3 PE=1 SV=1 8 119 2.0E-06
sp|Q9WUD1|CHIP_MOUSE STIP1 homology and U box-containing protein 1 OS=Mus musculus GN=Stub1 PE=1 SV=1 384 472 2.0E-06
sp|Q80ZK9|WDTC1_MOUSE WD and tetratricopeptide repeats protein 1 OS=Mus musculus GN=Wdtc1 PE=1 SV=1 381 473 2.0E-06
sp|Q8HXH0|LONF3_MACFA LON peptidase N-terminal domain and RING finger protein 3 OS=Macaca fascicularis GN=LONRF3 PE=2 SV=1 2 69 2.0E-06
sp|P53041|PPP5_HUMAN Serine/threonine-protein phosphatase 5 OS=Homo sapiens GN=PPP5C PE=1 SV=1 382 468 3.0E-06
sp|Q28IV3|RPAP3_XENTR RNA polymerase II-associated protein 3 OS=Xenopus tropicalis GN=rpap3 PE=2 SV=1 379 503 3.0E-06
sp|Q9H6T3|RPAP3_HUMAN RNA polymerase II-associated protein 3 OS=Homo sapiens GN=RPAP3 PE=1 SV=2 253 464 3.0E-06
sp|Q9D706|RPAP3_MOUSE RNA polymerase II-associated protein 3 OS=Mus musculus GN=Rpap3 PE=1 SV=1 8 119 3.0E-06
sp|Q80ZX8|SPAG1_MOUSE Sperm-associated antigen 1 OS=Mus musculus GN=Spag1 PE=1 SV=1 253 501 3.0E-06
sp|P53042|PPP5_RAT Serine/threonine-protein phosphatase 5 OS=Rattus norvegicus GN=Ppp5c PE=1 SV=1 382 468 4.0E-06
sp|Q68FQ7|RPAP3_RAT RNA polymerase II-associated protein 3 OS=Rattus norvegicus GN=Rpap3 PE=1 SV=1 253 464 4.0E-06
sp|Q84JR9|TTL4_ARATH TPR repeat-containing thioredoxin TTL4 OS=Arabidopsis thaliana GN=TTL4 PE=2 SV=1 370 465 4.0E-06
sp|Q99615|DNJC7_HUMAN DnaJ homolog subfamily C member 7 OS=Homo sapiens GN=DNAJC7 PE=1 SV=2 384 519 5.0E-06
sp|Q60676|PPP5_MOUSE Serine/threonine-protein phosphatase 5 OS=Mus musculus GN=Ppp5c PE=1 SV=3 382 468 5.0E-06
sp|Q99L47|F10A1_MOUSE Hsc70-interacting protein OS=Mus musculus GN=St13 PE=1 SV=1 1 81 5.0E-06
sp|Q86DS1|F10A2_DROME Hsc70-interacting protein 2 OS=Drosophila melanogaster GN=HIP-R PE=1 SV=2 4 102 6.0E-06
sp|C4NYP8|F10A1_DROME Hsc70-interacting protein 1 OS=Drosophila melanogaster GN=HIP PE=1 SV=2 4 102 6.0E-06
sp|Q9QYI3|DNJC7_MOUSE DnaJ homolog subfamily C member 7 OS=Mus musculus GN=Dnajc7 PE=1 SV=2 384 493 7.0E-06
sp|Q84JR9|TTL4_ARATH TPR repeat-containing thioredoxin TTL4 OS=Arabidopsis thaliana GN=TTL4 PE=2 SV=1 338 472 7.0E-06
sp|Q7ZU45|TTC25_DANRE Tetratricopeptide repeat protein 25 OS=Danio rerio GN=ttc25 PE=2 SV=1 11 124 7.0E-06
sp|P0CT30|SGT2_USTMA Small glutamine-rich tetratricopeptide repeat-containing protein 2 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=UMAG_10205 PE=3 SV=1 249 362 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 66 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|3875
MASADELKALGNKAIADKNFDEAIDKFTQAIALQPENHILYSNRSAAYASKKQWDDALNDADKTTEIKPDWAKGW
GRKGAALHGKGDLLGANDAYEQGLKLEASNAQLKSGLASVQKAMQQEAGGAGMDPTGGLTNMFNDPALLQKLASN
PKTSAFLADPSFMASLQQIQKNPQNATQLFSDPRMIQVLGVLMGVDMDMRDAPPEASQDTPMPDAPPKPTSQSQK
TREPEAEPEELDEAALEKKKKKEEADKIKALGTENYKKRNFDEAIKFYNEAWDLYPDITYLNNLGAAYYEKGDYD
HCIEACNKAIDEGRQIYADFKLISKSYARIGSAYEKKGDYALAIENYNRSLTEHRTPDVLKKLRDAERVKADSAK
KAYVDPEKAEEAREEGNKKFKEMDFPGAVASYSEMIKRAPEDPRGYSNRAAAFIKLFEFPSALDDCNAAIKKDPV
FIRAYIRRAQAFFGMRKYSECVDACTEAQQVDTEHHKGANAREIEQQQQKAFSAMYSARDNETEEQTRERLMRDP
DIMGIMQDPVMQSILQQAQSDPKALQEHMRNPSVRTKIQKLIAAGVIRVGR*
Coding >OphauG2|3875
ATGGCTTCGGCGGATGAGCTGAAAGCTCTTGGCAACAAGGCCATTGCAGACAAGAATTTCGACGAGGCAATCGAC
AAGTTTACCCAGGCAATCGCACTCCAACCCGAAAACCACATTCTCTACAGCAACCGCTCTGCGGCTTACGCCTCC
AAGAAGCAGTGGGACGATGCGCTTAATGATGCCGACAAAACAACAGAAATTAAGCCAGACTGGGCCAAGGGATGG
GGACGCAAAGGTGCTGCGCTGCATGGCAAGGGTGATCTGCTCGGGGCCAACGACGCCTACGAACAAGGCCTGAAG
CTTGAGGCAAGCAATGCCCAACTCAAAAGCGGCCTTGCTTCGGTTCAAAAAGCCATGCAACAAGAAGCTGGCGGC
GCAGGAATGGACCCCACGGGTGGCTTGACCAACATGTTCAATGACCCTGCCCTTCTTCAGAAGCTGGCATCAAAC
CCCAAGACGAGTGCCTTTTTAGCGGATCCCTCATTCATGGCCAGCTTGCAGCAGATCCAAAAGAACCCTCAGAAC
GCCACCCAGCTCTTCTCCGATCCCAGAATGATTCAAGTTTTGGGAGTTCTAATGGGTGTTGACATGGATATGCGC
GACGCTCCTCCCGAAGCTTCTCAGGATACCCCCATGCCTGATGCGCCTCCCAAGCCTACTAGTCAGTCTCAAAAG
ACTCGAGAGCCCGAAGCCGAACCTGAGGAGTTAGACGAAGCGGCCCTAGAAAAGAAGAAGAAGAAGGAGGAAGCG
GATAAGATCAAAGCACTAGGGACAGAAAATTACAAGAAGCGTAATTTCGACGAGGCCATCAAGTTCTATAACGAG
GCCTGGGATCTATATCCAGACATTACTTACCTTAACAACTTGGGTGCAGCATACTATGAAAAGGGAGACTACGAC
CATTGTATTGAGGCTTGCAACAAGGCCATTGATGAGGGGCGCCAGATATACGCCGACTTCAAGCTCATCTCCAAA
AGCTACGCCCGCATTGGCTCCGCGTACGAGAAAAAGGGCGATTATGCACTTGCCATTGAAAACTATAACAGATCC
CTCACAGAGCACCGAACGCCTGATGTCCTCAAGAAGCTGCGTGATGCGGAGCGCGTCAAAGCTGACTCTGCCAAG
AAGGCTTACGTCGACCCAGAAAAGGCCGAGGAAGCACGTGAGGAAGGGAACAAGAAATTCAAGGAGATGGACTTT
CCCGGGGCGGTCGCTTCCTATTCCGAGATGATTAAGAGGGCACCCGAAGACCCTCGTGGATACAGTAACCGGGCT
GCGGCCTTTATCAAGCTGTTTGAATTTCCGAGCGCACTTGACGACTGCAATGCTGCCATCAAGAAGGATCCGGTA
TTCATTCGGGCCTATATTCGCAGAGCTCAGGCCTTTTTTGGCATGAGAAAATACTCTGAATGTGTCGACGCCTGT
ACAGAAGCGCAGCAGGTAGATACGGAGCACCACAAGGGCGCCAATGCGCGCGAGATTGAGCAACAGCAGCAAAAG
GCATTTAGCGCCATGTACTCTGCACGGGACAATGAGACGGAGGAGCAGACTCGGGAGCGGCTGATGAGGGATCCA
GATATCATGGGCATCATGCAAGACCCGGTCATGCAGTCGATTTTGCAACAGGCTCAGTCGGACCCTAAGGCGTTG
CAAGAGCATATGCGCAACCCCAGTGTGCGAACCAAGATTCAAAAGCTGATTGCTGCCGGTGTCATTAGAGTTGGT
CGGTAG
Transcript >OphauG2|3875
ATGGCTTCGGCGGATGAGCTGAAAGCTCTTGGCAACAAGGCCATTGCAGACAAGAATTTCGACGAGGCAATCGAC
AAGTTTACCCAGGCAATCGCACTCCAACCCGAAAACCACATTCTCTACAGCAACCGCTCTGCGGCTTACGCCTCC
AAGAAGCAGTGGGACGATGCGCTTAATGATGCCGACAAAACAACAGAAATTAAGCCAGACTGGGCCAAGGGATGG
GGACGCAAAGGTGCTGCGCTGCATGGCAAGGGTGATCTGCTCGGGGCCAACGACGCCTACGAACAAGGCCTGAAG
CTTGAGGCAAGCAATGCCCAACTCAAAAGCGGCCTTGCTTCGGTTCAAAAAGCCATGCAACAAGAAGCTGGCGGC
GCAGGAATGGACCCCACGGGTGGCTTGACCAACATGTTCAATGACCCTGCCCTTCTTCAGAAGCTGGCATCAAAC
CCCAAGACGAGTGCCTTTTTAGCGGATCCCTCATTCATGGCCAGCTTGCAGCAGATCCAAAAGAACCCTCAGAAC
GCCACCCAGCTCTTCTCCGATCCCAGAATGATTCAAGTTTTGGGAGTTCTAATGGGTGTTGACATGGATATGCGC
GACGCTCCTCCCGAAGCTTCTCAGGATACCCCCATGCCTGATGCGCCTCCCAAGCCTACTAGTCAGTCTCAAAAG
ACTCGAGAGCCCGAAGCCGAACCTGAGGAGTTAGACGAAGCGGCCCTAGAAAAGAAGAAGAAGAAGGAGGAAGCG
GATAAGATCAAAGCACTAGGGACAGAAAATTACAAGAAGCGTAATTTCGACGAGGCCATCAAGTTCTATAACGAG
GCCTGGGATCTATATCCAGACATTACTTACCTTAACAACTTGGGTGCAGCATACTATGAAAAGGGAGACTACGAC
CATTGTATTGAGGCTTGCAACAAGGCCATTGATGAGGGGCGCCAGATATACGCCGACTTCAAGCTCATCTCCAAA
AGCTACGCCCGCATTGGCTCCGCGTACGAGAAAAAGGGCGATTATGCACTTGCCATTGAAAACTATAACAGATCC
CTCACAGAGCACCGAACGCCTGATGTCCTCAAGAAGCTGCGTGATGCGGAGCGCGTCAAAGCTGACTCTGCCAAG
AAGGCTTACGTCGACCCAGAAAAGGCCGAGGAAGCACGTGAGGAAGGGAACAAGAAATTCAAGGAGATGGACTTT
CCCGGGGCGGTCGCTTCCTATTCCGAGATGATTAAGAGGGCACCCGAAGACCCTCGTGGATACAGTAACCGGGCT
GCGGCCTTTATCAAGCTGTTTGAATTTCCGAGCGCACTTGACGACTGCAATGCTGCCATCAAGAAGGATCCGGTA
TTCATTCGGGCCTATATTCGCAGAGCTCAGGCCTTTTTTGGCATGAGAAAATACTCTGAATGTGTCGACGCCTGT
ACAGAAGCGCAGCAGGTAGATACGGAGCACCACAAGGGCGCCAATGCGCGCGAGATTGAGCAACAGCAGCAAAAG
GCATTTAGCGCCATGTACTCTGCACGGGACAATGAGACGGAGGAGCAGACTCGGGAGCGGCTGATGAGGGATCCA
GATATCATGGGCATCATGCAAGACCCGGTCATGCAGTCGATTTTGCAACAGGCTCAGTCGGACCCTAAGGCGTTG
CAAGAGCATATGCGCAACCCCAGTGTGCGAACCAAGATTCAAAAGCTGATTGCTGCCGGTGTCATTAGAGTTGGT
CGGTAG
Gene >OphauG2|3875
ATGGCTTCGGCGGATGAGCTGAAAGCTCTTGGCAACAAGGCCATTGCAGACAAGAATTTCGACGAGGCAATGTAC
GTCGCAAGGAATCTCCCCTCTCCCCCCTCTTTCTGCCGTAACACCGCCATGATCTGACATTTGATTCTACAGCGA
CAAGTTTACCCAGGCAATCGCACTCCAACCCGAAAACCACATTCTCTACAGCAACCGCTCTGCGGCTTACGCCTC
CAAGAAGCAGTGGGACGATGCGCTTAATGATGCCGACAAAACAACAGAAATTAAGCCAGACTGGGCCAAGGGATG
GGGACGCAAAGGTGCTGCGCTGCATGGCAAGGGTGATCTGCTCGGGGCCAACGACGCCTACGAACAAGGCCTGAA
GCTTGAGGCAAGCAATGCCCAACTCAAAAGCGGCCTTGCTTCGGTTCAAAAAGCCATGCAACAAGAAGCTGGTAA
GCATCCGTGCGTTTTCCTCGGCTTAGCAGCAGCTGATCTGATCTGAACATCCAGGCGGCGCAGGAATGGACCCCA
CGGGTGGCTTGACCAACATGTTCAATGACCCTGCCCTTCTTCAGAAGCTGGCATCAAACCCCAAGACGAGTGCCT
TTTTAGCGGATCCCTCATTCATGGCCAGCTTGCAGCAGATCCAAAAGAACCCTCAGAACGCCACCCAGCTCTTCT
CCGATCCCAGAATGATTCAAGTTTTGGGAGTTCTAATGGGTGTTGACATGGATATGCGCGACGCTCCTCCCGAAG
CTTCTCAGGATACCCCCATGCCTGATGCGCCTCCCAAGCCTACTAGTCAGTCTCAAAAGACTCGAGAGCCCGAAG
CCGAACCTGAGGAGTTAGACGAAGCGGCCCTAGAAAAGAAGAAGAAGAAGGAGGAAGCGGATAAGATCAAAGCAC
TAGGGACAGAAAATTACAAGAAGCGTAATTTCGACGAGGCCATCAAGTTCTATAACGAGGCCTGGGATCTATATC
CAGACATTACTTACCTTAACAACTTGGGTGCAGCATACTATGAAAAGGGAGACTACGACCATTGTATTGAGGCTT
GCAACAAGGCCATTGATGAGGGGCGCCAGATATACGCCGACTTCAAGCTCATCTCCAAAAGCTACGCCCGCATTG
GCTCCGCGTACGAGAAAAAGGGCGATTATGCACTTGCCATTGAAAACTATAACAGATCCCTCACAGAGCACCGAA
CGCCTGATGTCCTCAAGAAGCTGCGTGATGCGGAGCGCGTCAAAGCTGACTCTGCCAAGAAGGCTTACGTCGACC
CAGAAAAGGCCGAGGAAGCACGTGAGGAAGGGAACAAGAAATTCAAGGAGATGGACTTTCCCGGGGCGGTCGCTT
CCTATTCCGAGATGATTAAGAGGGCACCCGAAGACCCTCGTGGATACAGTAACCGGGCTGCGGCCTTTATCAAGC
TGTTTGAATTTCCGAGCGCACTTGACGACTGCAATGCTGCCATCAAGAAGGATCCGGTATTCATTCGGGCCTATA
TTCGCAGAGCTCAGGCCTTTTTTGGCATGAGAAAATACTCTGAATGTGTCGACGCCTGTACAGAAGCGCAGCAGG
TAGATACGGAGCACCACAAGGGCGCCAATGCGCGCGAGATTGAGCAACAGCAGCAAAAGGCATTTAGCGCCATGT
ACTCTGCACGGGACAATGAGACGGAGGAGCAGACTCGGGAGCGGCTGATGAGGGATCCAGATGTGAGTCGTGGGG
GCGAACCAAAGATGGCGAGAAGAAGGCGCTGCTGACATGAGGCTTTTTTTTCTTCACACAGATCATGGGCATCAT
GCAAGACCCGGTCATGCAGTCGATTTTGCAACAGGCTCAGTCGGACCCTAAGGCGTTGCAAGAGCATATGCGCAA
CCCCAGTGTGCGAACCAAGATTCAAAAGCTGATTGCTGCCGGTGTCATTAGAGTTGGTCGGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail