Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|3871
Gene name
LocationContig_302:16138..17731
Strand-
Gene length (bp)1593
Transcript length (bp)1461
Coding sequence length (bp)1461
Protein length (aa) 487

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00346 Complex1_49kDa Respiratory-chain NADH dehydrogenase, 49 Kd subunit 1.6E-122 216 486

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P22142|NDUS2_NEUCR NADH-ubiquinone oxidoreductase 49 kDa subunit, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nuo-49 PE=1 SV=2 4 486 0.0E+00
sp|Q641Y2|NDUS2_RAT NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial OS=Rattus norvegicus GN=Ndufs2 PE=1 SV=1 93 486 0.0E+00
sp|Q91WD5|NDUS2_MOUSE NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial OS=Mus musculus GN=Ndufs2 PE=1 SV=1 95 486 0.0E+00
sp|P17694|NDUS2_BOVIN NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial OS=Bos taurus GN=NDUFS2 PE=1 SV=2 76 486 0.0E+00
sp|O21270|NDUS2_RECAM NADH-ubiquinone oxidoreductase 49 kDa subunit OS=Reclinomonas americana GN=NAD7 PE=3 SV=1 98 486 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P22142|NDUS2_NEUCR NADH-ubiquinone oxidoreductase 49 kDa subunit, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nuo-49 PE=1 SV=2 4 486 0.0E+00
sp|Q641Y2|NDUS2_RAT NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial OS=Rattus norvegicus GN=Ndufs2 PE=1 SV=1 93 486 0.0E+00
sp|Q91WD5|NDUS2_MOUSE NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial OS=Mus musculus GN=Ndufs2 PE=1 SV=1 95 486 0.0E+00
sp|P17694|NDUS2_BOVIN NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial OS=Bos taurus GN=NDUFS2 PE=1 SV=2 76 486 0.0E+00
sp|O21270|NDUS2_RECAM NADH-ubiquinone oxidoreductase 49 kDa subunit OS=Reclinomonas americana GN=NAD7 PE=3 SV=1 98 486 0.0E+00
sp|Q0MQG4|NDUS2_GORGO NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial OS=Gorilla gorilla gorilla GN=NDUFS2 PE=2 SV=1 100 486 0.0E+00
sp|Q0MQG3|NDUS2_PONPY NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial OS=Pongo pygmaeus GN=NDUFS2 PE=2 SV=1 76 486 0.0E+00
sp|Q0MQG5|NDUS2_PANTR NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial OS=Pan troglodytes GN=NDUFS2 PE=2 SV=1 100 486 0.0E+00
sp|O75306|NDUS2_HUMAN NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial OS=Homo sapiens GN=NDUFS2 PE=1 SV=2 100 486 0.0E+00
sp|Q9TC96|NDUS2_NEPOL NADH dehydrogenase [ubiquinone] iron-sulfur protein 2 OS=Nephroselmis olivacea GN=NAD7 PE=3 SV=1 94 486 0.0E+00
sp|Q37619|NDUS2_PROWI NADH-ubiquinone oxidoreductase 49 kDa subunit OS=Prototheca wickerhamii GN=NAD7 PE=3 SV=1 99 486 0.0E+00
sp|Q37720|NDUS2_PYLLI NADH-ubiquinone oxidoreductase 49 kDa subunit OS=Pylaiella littoralis GN=NAD7 PE=3 SV=1 102 486 0.0E+00
sp|Q93873|NDUS2_CAEEL Probable NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial OS=Caenorhabditis elegans GN=gas-1 PE=3 SV=2 98 486 0.0E+00
sp|P93306|NDUS2_ARATH NADH dehydrogenase [ubiquinone] iron-sulfur protein 2 OS=Arabidopsis thaliana GN=NAD7 PE=2 SV=2 94 486 0.0E+00
sp|Q37384|NDUS2_ACACA NADH-ubiquinone oxidoreductase 49 kDa subunit OS=Acanthamoeba castellanii GN=NAD7 PE=3 SV=1 87 486 0.0E+00
sp|Q5GTF8|NUOD_WOLTR NADH-quinone oxidoreductase subunit D OS=Wolbachia sp. subsp. Brugia malayi (strain TRS) GN=nuoD PE=3 SV=1 100 486 0.0E+00
sp|B3CLH1|NUOD_WOLPP NADH-quinone oxidoreductase subunit D OS=Wolbachia pipientis subsp. Culex pipiens (strain wPip) GN=nuoD PE=3 SV=1 100 486 0.0E+00
sp|Q5HB88|NUOD_EHRRW NADH-quinone oxidoreductase subunit D OS=Ehrlichia ruminantium (strain Welgevonden) GN=nuoD PE=3 SV=1 96 486 0.0E+00
sp|Q9TAJ7|NDUS2_CAFRO NADH-ubiquinone oxidoreductase 49 kDa subunit OS=Cafeteria roenbergensis GN=NAD7 PE=3 SV=1 92 486 0.0E+00
sp|Q2GGK7|NUOD_EHRCR NADH-quinone oxidoreductase subunit D OS=Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas) GN=nuoD PE=3 SV=1 99 486 0.0E+00
sp|Q3YS37|NUOD_EHRCJ NADH-quinone oxidoreductase subunit D OS=Ehrlichia canis (strain Jake) GN=nuoD PE=3 SV=1 99 486 0.0E+00
sp|B6ISX8|NUOD_RHOCS NADH-quinone oxidoreductase subunit D OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=nuoD PE=3 SV=1 93 486 0.0E+00
sp|Q5FGV3|NUOD_EHRRG NADH-quinone oxidoreductase subunit D OS=Ehrlichia ruminantium (strain Gardel) GN=nuoD PE=3 SV=1 96 486 0.0E+00
sp|Q73HJ8|NUOD_WOLPM NADH-quinone oxidoreductase subunit D OS=Wolbachia pipientis wMel GN=nuoD PE=3 SV=1 100 486 0.0E+00
sp|A9HRT9|NUOD_GLUDA NADH-quinone oxidoreductase subunit D OS=Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / PAl5) GN=nuoD PE=3 SV=2 82 486 0.0E+00
sp|A7HY46|NUOD_PARL1 NADH-quinone oxidoreductase subunit D OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=nuoD PE=3 SV=1 98 486 0.0E+00
sp|B3CSH1|NUOD_ORITI NADH-quinone oxidoreductase subunit D OS=Orientia tsutsugamushi (strain Ikeda) GN=nuoD PE=3 SV=1 101 486 0.0E+00
sp|Q2W3I7|NUOD_MAGSA NADH-quinone oxidoreductase subunit D OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=nuoD PE=3 SV=1 99 486 0.0E+00
sp|Q5PAR3|NUOD_ANAMM NADH-quinone oxidoreductase subunit D OS=Anaplasma marginale (strain St. Maries) GN=nuoD PE=3 SV=1 99 486 0.0E+00
sp|Q4FM88|NUOD_PELUB NADH-quinone oxidoreductase subunit D OS=Pelagibacter ubique (strain HTCC1062) GN=nuoD PE=3 SV=1 98 486 0.0E+00
sp|A5CES2|NUOD_ORITB NADH-quinone oxidoreductase subunit D OS=Orientia tsutsugamushi (strain Boryong) GN=nuoD PE=3 SV=1 101 486 0.0E+00
sp|Q2RU37|NUOD_RHORT NADH-quinone oxidoreductase subunit D OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=nuoD PE=3 SV=1 99 486 0.0E+00
sp|Q0BSK5|NUOD_GRABC NADH-quinone oxidoreductase subunit D OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=nuoD PE=3 SV=1 99 486 0.0E+00
sp|Q11JK3|NUOD_CHESB NADH-quinone oxidoreductase subunit D OS=Chelativorans sp. (strain BNC1) GN=nuoD PE=3 SV=1 100 486 0.0E+00
sp|Q4UM08|NUOD_RICFE NADH-quinone oxidoreductase subunit D OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=nuoD PE=3 SV=1 104 486 0.0E+00
sp|Q1RJI9|NUOD_RICBR NADH-quinone oxidoreductase subunit D OS=Rickettsia bellii (strain RML369-C) GN=nuoD PE=3 SV=2 98 486 0.0E+00
sp|A8GX80|NUOD_RICB8 NADH-quinone oxidoreductase subunit D OS=Rickettsia bellii (strain OSU 85-389) GN=nuoD PE=3 SV=1 98 486 0.0E+00
sp|Q89KI9|NUOD_BRADU NADH-quinone oxidoreductase subunit D OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=nuoD PE=3 SV=1 99 486 0.0E+00
sp|Q215I0|NUOD_RHOPB NADH-quinone oxidoreductase subunit D OS=Rhodopseudomonas palustris (strain BisB18) GN=nuoD PE=3 SV=1 100 486 0.0E+00
sp|A8GN50|NUOD_RICAH NADH-quinone oxidoreductase subunit D OS=Rickettsia akari (strain Hartford) GN=nuoD PE=3 SV=2 104 486 0.0E+00
sp|B0ULK7|NUOD_METS4 NADH-quinone oxidoreductase subunit D OS=Methylobacterium sp. (strain 4-46) GN=nuoD PE=3 SV=1 96 486 0.0E+00
sp|A5FX11|NUOD_ACICJ NADH-quinone oxidoreductase subunit D OS=Acidiphilium cryptum (strain JF-5) GN=nuoD PE=3 SV=1 103 486 0.0E+00
sp|Q92ID8|NUOD_RICCN NADH-quinone oxidoreductase subunit D OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=nuoD PE=3 SV=2 104 486 0.0E+00
sp|B0BX71|NUOD_RICRO NADH-quinone oxidoreductase subunit D OS=Rickettsia rickettsii (strain Iowa) GN=nuoD PE=3 SV=2 104 486 0.0E+00
sp|B3Q7N3|NUOD_RHOPT NADH-quinone oxidoreductase subunit D OS=Rhodopseudomonas palustris (strain TIE-1) GN=nuoD PE=3 SV=1 100 486 0.0E+00
sp|B4RPI1|NUOD_NEIG2 NADH-quinone oxidoreductase subunit D OS=Neisseria gonorrhoeae (strain NCCP11945) GN=nuoD PE=3 SV=1 99 486 0.0E+00
sp|Q5F618|NUOD_NEIG1 NADH-quinone oxidoreductase subunit D OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=nuoD PE=3 SV=1 99 486 0.0E+00
sp|Q9K1C0|NUOD_NEIMB NADH-quinone oxidoreductase subunit D OS=Neisseria meningitidis serogroup B (strain MC58) GN=nuoD PE=3 SV=1 99 486 0.0E+00
sp|Q2IWY2|NUOD_RHOP2 NADH-quinone oxidoreductase subunit D OS=Rhodopseudomonas palustris (strain HaA2) GN=nuoD PE=3 SV=1 91 486 0.0E+00
sp|Q6N5M5|NUOD_RHOPA NADH-quinone oxidoreductase subunit D OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=nuoD PE=3 SV=1 100 486 0.0E+00
sp|A8EZ86|NUOD_RICCK NADH-quinone oxidoreductase subunit D OS=Rickettsia canadensis (strain McKiel) GN=nuoD PE=3 SV=2 98 486 0.0E+00
sp|A1INN7|NUOD_NEIMA NADH-quinone oxidoreductase subunit D OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=nuoD PE=3 SV=1 99 486 0.0E+00
sp|A8GRR5|NUOD_RICRS NADH-quinone oxidoreductase subunit D OS=Rickettsia rickettsii (strain Sheila Smith) GN=nuoD PE=3 SV=1 104 486 0.0E+00
sp|Q9ZDH4|NUOD_RICPR NADH-quinone oxidoreductase subunit D OS=Rickettsia prowazekii (strain Madrid E) GN=nuoD PE=3 SV=1 104 486 0.0E+00
sp|A1KRS5|NUOD_NEIMF NADH-quinone oxidoreductase subunit D OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=nuoD PE=3 SV=1 99 486 0.0E+00
sp|B6JGW3|NUOD_OLICO NADH-quinone oxidoreductase subunit D OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=nuoD PE=3 SV=1 101 486 0.0E+00
sp|A8F1C5|NUOD_RICM5 NADH-quinone oxidoreductase subunit D OS=Rickettsia massiliae (strain Mtu5) GN=nuoD PE=3 SV=2 104 486 0.0E+00
sp|A9CJA9|NUOD_AGRFC NADH-quinone oxidoreductase subunit D OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=nuoD PE=3 SV=1 96 486 0.0E+00
sp|A5EK97|NUOD_BRASB NADH-quinone oxidoreductase subunit D OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=nuoD PE=3 SV=1 100 486 0.0E+00
sp|Q68X19|NUOD_RICTY NADH-quinone oxidoreductase subunit D OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=nuoD PE=3 SV=2 104 486 0.0E+00
sp|Q98KQ8|NUOD_RHILO NADH-quinone oxidoreductase subunit D OS=Rhizobium loti (strain MAFF303099) GN=nuoD PE=3 SV=1 100 486 0.0E+00
sp|Q3SJQ4|NUOD_THIDA NADH-quinone oxidoreductase subunit D OS=Thiobacillus denitrificans (strain ATCC 25259) GN=nuoD PE=3 SV=1 99 486 0.0E+00
sp|A9M3D9|NUOD_NEIM0 NADH-quinone oxidoreductase subunit D OS=Neisseria meningitidis serogroup C (strain 053442) GN=nuoD PE=3 SV=1 99 486 0.0E+00
sp|Q8YGK3|NUOD_BRUME NADH-quinone oxidoreductase subunit D OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=nuoD PE=3 SV=1 99 486 0.0E+00
sp|Q1QL87|NUOD2_NITHX NADH-quinone oxidoreductase subunit D 2 OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=nuoD2 PE=3 SV=1 100 486 0.0E+00
sp|Q2GJY9|NUOD_ANAPZ NADH-quinone oxidoreductase subunit D OS=Anaplasma phagocytophilum (strain HZ) GN=nuoD PE=3 SV=1 104 486 0.0E+00
sp|A4WU31|NUOD_RHOS5 NADH-quinone oxidoreductase subunit D OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=nuoD PE=3 SV=1 98 486 0.0E+00
sp|Q07NM3|NUOD_RHOP5 NADH-quinone oxidoreductase subunit D OS=Rhodopseudomonas palustris (strain BisA53) GN=nuoD PE=3 SV=1 100 486 0.0E+00
sp|B0CLD2|NUOD_BRUSI NADH-quinone oxidoreductase subunit D OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=nuoD PE=3 SV=1 99 486 0.0E+00
sp|A5VPY6|NUOD_BRUO2 NADH-quinone oxidoreductase subunit D OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=nuoD PE=3 SV=1 99 486 0.0E+00
sp|A9MAI2|NUOD_BRUC2 NADH-quinone oxidoreductase subunit D OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=nuoD PE=3 SV=1 99 486 0.0E+00
sp|A3PIX1|NUOD_RHOS1 NADH-quinone oxidoreductase subunit D OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=nuoD PE=3 SV=1 98 486 0.0E+00
sp|Q3J3F8|NUOD_RHOS4 NADH-quinone oxidoreductase subunit D OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=nuoD PE=3 SV=1 98 486 0.0E+00
sp|Q1QP34|NUOD1_NITHX NADH-quinone oxidoreductase subunit D 1 OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=nuoD1 PE=3 SV=1 101 486 0.0E+00
sp|B1LUN4|NUOD_METRJ NADH-quinone oxidoreductase subunit D OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=nuoD PE=3 SV=1 96 486 0.0E+00
sp|A6X1N0|NUOD_OCHA4 NADH-quinone oxidoreductase subunit D OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=nuoD PE=3 SV=1 99 486 0.0E+00
sp|Q2YA24|NUOD_NITMU NADH-quinone oxidoreductase subunit D OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=nuoD PE=3 SV=1 99 486 0.0E+00
sp|Q135X7|NUOD_RHOPS NADH-quinone oxidoreductase subunit D OS=Rhodopseudomonas palustris (strain BisB5) GN=nuoD PE=3 SV=1 100 486 0.0E+00
sp|Q36450|NDUS2_NICSY NADH dehydrogenase [ubiquinone] iron-sulfur protein 2 OS=Nicotiana sylvestris GN=NAD7 PE=2 SV=1 94 486 0.0E+00
sp|Q8G1B4|NUOD_BRUSU NADH-quinone oxidoreductase subunit D OS=Brucella suis biovar 1 (strain 1330) GN=nuoD PE=3 SV=1 99 486 0.0E+00
sp|Q3SRE6|NUOD_NITWN NADH-quinone oxidoreductase subunit D OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=nuoD PE=3 SV=1 100 486 0.0E+00
sp|A4YVK9|NUOD_BRASO NADH-quinone oxidoreductase subunit D OS=Bradyrhizobium sp. (strain ORS278) GN=nuoD PE=3 SV=1 100 486 0.0E+00
sp|B0SZ49|NUOD_CAUSK NADH-quinone oxidoreductase subunit D OS=Caulobacter sp. (strain K31) GN=nuoD PE=3 SV=1 67 486 0.0E+00
sp|A9W1N0|NUOD_METEP NADH-quinone oxidoreductase subunit D OS=Methylobacterium extorquens (strain PA1) GN=nuoD PE=3 SV=1 96 486 0.0E+00
sp|Q0APY7|NUOD_MARMM NADH-quinone oxidoreductase subunit D OS=Maricaulis maris (strain MCS10) GN=nuoD PE=3 SV=1 101 486 0.0E+00
sp|Q9A6X4|NUOD_CAUCR NADH-quinone oxidoreductase subunit D OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=nuoD PE=3 SV=1 100 486 0.0E+00
sp|B5ZYL5|NUOD_RHILW NADH-quinone oxidoreductase subunit D OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=nuoD PE=3 SV=1 96 486 0.0E+00
sp|Q5LPR7|NUOD_RUEPO NADH-quinone oxidoreductase subunit D OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=nuoD PE=3 SV=1 98 486 0.0E+00
sp|Q57DU8|NUOD_BRUAB NADH-quinone oxidoreductase subunit D OS=Brucella abortus biovar 1 (strain 9-941) GN=nuoD PE=3 SV=1 99 486 0.0E+00
sp|Q2YNG0|NUOD_BRUA2 NADH-quinone oxidoreductase subunit D OS=Brucella abortus (strain 2308) GN=nuoD PE=3 SV=1 99 486 0.0E+00
sp|B2S546|NUOD_BRUA1 NADH-quinone oxidoreductase subunit D OS=Brucella abortus (strain S19) GN=nuoD PE=3 SV=1 99 486 0.0E+00
sp|B2ILG7|NUOD2_BEII9 NADH-quinone oxidoreductase subunit D 2 OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=nuoD2 PE=3 SV=1 101 486 0.0E+00
sp|A9IUP7|NUOD_BART1 NADH-quinone oxidoreductase subunit D OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=nuoD PE=3 SV=1 99 486 0.0E+00
sp|B1ZA43|NUOD_METPB NADH-quinone oxidoreductase subunit D OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=nuoD PE=3 SV=1 96 486 0.0E+00
sp|A8I3Z3|NUOD_AZOC5 NADH-quinone oxidoreductase subunit D OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=nuoD PE=3 SV=1 100 486 0.0E+00
sp|B2T2F0|NUOD_BURPP NADH-quinone oxidoreductase subunit D OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=nuoD PE=3 SV=1 99 486 0.0E+00
sp|B4RCM6|NUOD_PHEZH NADH-quinone oxidoreductase subunit D OS=Phenylobacterium zucineum (strain HLK1) GN=nuoD PE=3 SV=1 99 486 0.0E+00
sp|Q142H0|NUOD_BURXL NADH-quinone oxidoreductase subunit D OS=Burkholderia xenovorans (strain LB400) GN=nuoD PE=3 SV=1 99 486 0.0E+00
sp|B3PW00|NUOD1_RHIE6 NADH-quinone oxidoreductase subunit D 1 OS=Rhizobium etli (strain CIAT 652) GN=nuoD1 PE=3 SV=1 96 486 0.0E+00
sp|Q2GDJ8|NUOD_NEOSM NADH-quinone oxidoreductase subunit D OS=Neorickettsia sennetsu (strain Miyayama) GN=nuoD PE=3 SV=1 105 486 0.0E+00
sp|A1W4M5|NUOD_ACISJ NADH-quinone oxidoreductase subunit D OS=Acidovorax sp. (strain JS42) GN=nuoD PE=3 SV=1 99 486 0.0E+00
sp|B4E5L9|NUOD_BURCJ NADH-quinone oxidoreductase subunit D OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=nuoD PE=3 SV=1 99 486 0.0E+00
sp|A0K920|NUOD_BURCH NADH-quinone oxidoreductase subunit D OS=Burkholderia cenocepacia (strain HI2424) GN=nuoD PE=3 SV=1 99 486 0.0E+00
sp|Q1BV16|NUOD_BURCA NADH-quinone oxidoreductase subunit D OS=Burkholderia cenocepacia (strain AU 1054) GN=nuoD PE=3 SV=1 99 486 0.0E+00
sp|A6SY08|NUOD_JANMA NADH-quinone oxidoreductase subunit D OS=Janthinobacterium sp. (strain Marseille) GN=nuoD PE=3 SV=1 99 486 0.0E+00
sp|Q6FZY8|NUOD_BARQU NADH-quinone oxidoreductase subunit D OS=Bartonella quintana (strain Toulouse) GN=nuoD PE=3 SV=1 99 486 0.0E+00
sp|Q2K9T1|NUOD1_RHIEC NADH-quinone oxidoreductase subunit D 1 OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=nuoD1 PE=3 SV=1 96 486 1.0E-180
sp|Q2KV09|NUOD_BORA1 NADH-quinone oxidoreductase subunit D OS=Bordetella avium (strain 197N) GN=nuoD PE=3 SV=1 99 486 1.0E-180
sp|A7IPA4|NUOD_XANP2 NADH-quinone oxidoreductase subunit D OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=nuoD PE=3 SV=1 99 486 1.0E-180
sp|Q163Q5|NUOD_ROSDO NADH-quinone oxidoreductase subunit D OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=nuoD PE=3 SV=1 98 486 1.0E-180
sp|A1USX0|NUOD_BARBK NADH-quinone oxidoreductase subunit D OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=nuoD PE=3 SV=1 99 486 1.0E-180
sp|Q7NZH8|NUOD_CHRVO NADH-quinone oxidoreductase subunit D OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=nuoD PE=3 SV=1 99 486 1.0E-180
sp|P56907|NUOD1_RHIME NADH-quinone oxidoreductase subunit D 1 OS=Rhizobium meliloti (strain 1021) GN=nuoD1 PE=3 SV=1 96 486 2.0E-180
sp|Q63VN0|NUOD_BURPS NADH-quinone oxidoreductase subunit D OS=Burkholderia pseudomallei (strain K96243) GN=nuoD PE=3 SV=1 99 486 2.0E-180
sp|A3N7M0|NUOD_BURP6 NADH-quinone oxidoreductase subunit D OS=Burkholderia pseudomallei (strain 668) GN=nuoD PE=3 SV=1 99 486 2.0E-180
sp|Q3JUA6|NUOD_BURP1 NADH-quinone oxidoreductase subunit D OS=Burkholderia pseudomallei (strain 1710b) GN=nuoD PE=3 SV=1 99 486 2.0E-180
sp|A3NTA9|NUOD_BURP0 NADH-quinone oxidoreductase subunit D OS=Burkholderia pseudomallei (strain 1106a) GN=nuoD PE=3 SV=1 99 486 2.0E-180
sp|A1V2L9|NUOD_BURMS NADH-quinone oxidoreductase subunit D OS=Burkholderia mallei (strain SAVP1) GN=nuoD PE=3 SV=1 99 486 2.0E-180
sp|Q62IN8|NUOD_BURMA NADH-quinone oxidoreductase subunit D OS=Burkholderia mallei (strain ATCC 23344) GN=nuoD PE=3 SV=1 99 486 2.0E-180
sp|A2S456|NUOD_BURM9 NADH-quinone oxidoreductase subunit D OS=Burkholderia mallei (strain NCTC 10229) GN=nuoD PE=3 SV=1 99 486 2.0E-180
sp|A3MIA4|NUOD_BURM7 NADH-quinone oxidoreductase subunit D OS=Burkholderia mallei (strain NCTC 10247) GN=nuoD PE=3 SV=1 99 486 2.0E-180
sp|Q2SZN2|NUOD_BURTA NADH-quinone oxidoreductase subunit D OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=nuoD PE=3 SV=1 99 486 5.0E-180
sp|Q1MIL2|NUOD_RHIL3 NADH-quinone oxidoreductase subunit D OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=nuoD PE=3 SV=1 96 486 6.0E-180
sp|Q39EE8|NUOD_BURL3 NADH-quinone oxidoreductase subunit D OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=nuoD PE=3 SV=1 99 486 6.0E-180
sp|A4JGC7|NUOD_BURVG NADH-quinone oxidoreductase subunit D OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=nuoD PE=3 SV=1 99 486 6.0E-180
sp|A9AFZ0|NUOD_BURM1 NADH-quinone oxidoreductase subunit D OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=nuoD PE=3 SV=1 99 486 6.0E-180
sp|Q0BDD3|NUOD_BURCM NADH-quinone oxidoreductase subunit D OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=nuoD PE=3 SV=1 99 486 1.0E-179
sp|B1JVN8|NUOD_BURCC NADH-quinone oxidoreductase subunit D OS=Burkholderia cenocepacia (strain MC0-3) GN=nuoD PE=3 SV=1 99 486 1.0E-179
sp|A6U7W6|NUOD1_SINMW NADH-quinone oxidoreductase subunit D 1 OS=Sinorhizobium medicae (strain WSM419) GN=nuoD1 PE=3 SV=1 96 486 1.0E-179
sp|B1YTQ4|NUOD_BURA4 NADH-quinone oxidoreductase subunit D OS=Burkholderia ambifaria (strain MC40-6) GN=nuoD PE=3 SV=1 99 486 2.0E-179
sp|Q6G391|NUOD_BARHE NADH-quinone oxidoreductase subunit D OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=nuoD PE=3 SV=1 99 486 2.0E-179
sp|Q7VZQ2|NUOD_BORPE NADH-quinone oxidoreductase subunit D OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=nuoD PE=3 SV=1 99 486 2.0E-179
sp|Q5P1E7|NUOD_AROAE NADH-quinone oxidoreductase subunit D OS=Aromatoleum aromaticum (strain EbN1) GN=nuoD PE=3 SV=1 99 486 3.0E-179
sp|Q2G5Y6|NUOD_NOVAD NADH-quinone oxidoreductase subunit D OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=nuoD PE=3 SV=1 100 486 4.0E-179
sp|Q7W5B0|NUOD_BORPA NADH-quinone oxidoreductase subunit D OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=nuoD PE=3 SV=1 99 486 4.0E-179
sp|Q7WCU2|NUOD_BORBR NADH-quinone oxidoreductase subunit D OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=nuoD PE=3 SV=1 99 486 4.0E-179
sp|B2JDM5|NUOD_BURP8 NADH-quinone oxidoreductase subunit D OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=nuoD PE=3 SV=1 99 486 4.0E-179
sp|A2SFM9|NUOD_METPP NADH-quinone oxidoreductase subunit D OS=Methylibium petroleiphilum (strain PM1) GN=nuoD PE=3 SV=1 99 486 5.0E-179
sp|A9II07|NUOD_BORPD NADH-quinone oxidoreductase subunit D OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=nuoD PE=3 SV=1 99 486 1.0E-178
sp|Q1GZL2|NUOD_METFK NADH-quinone oxidoreductase subunit D OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=nuoD PE=3 SV=1 99 486 1.0E-178
sp|A1TLL9|NUOD_ACIAC NADH-quinone oxidoreductase subunit D OS=Acidovorax citrulli (strain AAC00-1) GN=nuoD PE=3 SV=1 99 486 1.0E-178
sp|Q9PGJ2|NUOD_XYLFA NADH-quinone oxidoreductase subunit D OS=Xylella fastidiosa (strain 9a5c) GN=nuoD PE=3 SV=1 80 486 2.0E-178
sp|A1K5B1|NUOD_AZOSB NADH-quinone oxidoreductase subunit D OS=Azoarcus sp. (strain BH72) GN=nuoD PE=3 SV=1 99 486 2.0E-178
sp|B0U1W8|NUOD_XYLFM NADH-quinone oxidoreductase subunit D OS=Xylella fastidiosa (strain M12) GN=nuoD PE=3 SV=1 80 486 3.0E-178
sp|Q87EQ2|NUOD_XYLFT NADH-quinone oxidoreductase subunit D OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=nuoD PE=3 SV=1 80 486 6.0E-178
sp|B2I787|NUOD_XYLF2 NADH-quinone oxidoreductase subunit D OS=Xylella fastidiosa (strain M23) GN=nuoD PE=3 SV=1 80 486 6.0E-178
sp|A1B495|NUOD_PARDP NADH-quinone oxidoreductase subunit D OS=Paracoccus denitrificans (strain Pd 1222) GN=nuoD PE=1 SV=1 98 486 1.0E-177
sp|Q1GIN9|NUOD_RUEST NADH-quinone oxidoreductase subunit D OS=Ruegeria sp. (strain TM1040) GN=nuoD PE=3 SV=1 98 486 2.0E-177
sp|A1VM63|NUOD_POLNA NADH-quinone oxidoreductase subunit D OS=Polaromonas naphthalenivorans (strain CJ2) GN=nuoD PE=3 SV=1 99 486 2.0E-177
sp|Q0A778|NUOD_ALKEH NADH-quinone oxidoreductase subunit D OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=nuoD PE=3 SV=1 98 486 5.0E-177
sp|A4G641|NUOD_HERAR NADH-quinone oxidoreductase subunit D OS=Herminiimonas arsenicoxydans GN=nuoD PE=3 SV=1 99 486 5.0E-177
sp|B2FNX6|NUOD_STRMK NADH-quinone oxidoreductase subunit D OS=Stenotrophomonas maltophilia (strain K279a) GN=nuoD PE=3 SV=1 91 486 8.0E-177
sp|Q31HF7|NUOD_THICR NADH-quinone oxidoreductase subunit D OS=Thiomicrospira crunogena (strain XCL-2) GN=nuoD PE=3 SV=1 99 486 8.0E-177
sp|Q127X5|NUOD_POLSJ NADH-quinone oxidoreductase subunit D OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=nuoD PE=3 SV=1 99 486 9.0E-177
sp|P29916|NQO4_PARDE NADH-quinone oxidoreductase subunit 4 OS=Paracoccus denitrificans GN=nqo4 PE=1 SV=1 98 486 1.0E-176
sp|Q1GTK0|NUOD_SPHAL NADH-quinone oxidoreductase subunit D OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=nuoD PE=3 SV=2 89 486 2.0E-176
sp|B2U7Q8|NUOD_RALPJ NADH-quinone oxidoreductase subunit D OS=Ralstonia pickettii (strain 12J) GN=nuoD PE=3 SV=1 100 486 3.0E-176
sp|A1WLP1|NUOD_VEREI NADH-quinone oxidoreductase subunit D OS=Verminephrobacter eiseniae (strain EF01-2) GN=nuoD PE=3 SV=1 99 486 6.0E-176
sp|Q82TU6|NUOD_NITEU NADH-quinone oxidoreductase subunit D OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=nuoD PE=3 SV=1 99 486 7.0E-176
sp|B4SQT3|NUOD2_STRM5 NADH-quinone oxidoreductase subunit D 2 OS=Stenotrophomonas maltophilia (strain R551-3) GN=nuoD2 PE=3 SV=1 98 486 1.0E-175
sp|B4SJH6|NUOD1_STRM5 NADH-quinone oxidoreductase subunit D 1 OS=Stenotrophomonas maltophilia (strain R551-3) GN=nuoD1 PE=3 SV=1 99 486 1.0E-175
sp|Q28T72|NUOD_JANSC NADH-quinone oxidoreductase subunit D OS=Jannaschia sp. (strain CCS1) GN=nuoD PE=3 SV=1 98 486 1.0E-175
sp|Q5WT23|NUOD_LEGPL NADH-quinone oxidoreductase subunit D OS=Legionella pneumophila (strain Lens) GN=nuoD PE=3 SV=1 99 486 1.0E-175
sp|Q5ZRU1|NUOD_LEGPH NADH-quinone oxidoreductase subunit D OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=nuoD PE=3 SV=2 99 486 1.0E-175
sp|B1Y830|NUOD_LEPCP NADH-quinone oxidoreductase subunit D OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=nuoD PE=3 SV=1 99 486 2.0E-175
sp|A0LDS4|NUOD_MAGMM NADH-quinone oxidoreductase subunit D OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=nuoD PE=3 SV=1 95 486 2.0E-175
sp|Q0AHJ7|NUOD_NITEC NADH-quinone oxidoreductase subunit D OS=Nitrosomonas eutropha (strain C91) GN=nuoD PE=3 SV=1 100 486 2.0E-175
sp|A8LIT9|NUOD_DINSH NADH-quinone oxidoreductase subunit D OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=nuoD PE=3 SV=1 98 486 3.0E-175
sp|A4SXQ0|NUOD_POLSQ NADH-quinone oxidoreductase subunit D OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=nuoD PE=3 SV=1 99 486 4.0E-175
sp|A5VAM0|NUOD_SPHWW NADH-quinone oxidoreductase subunit D OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=nuoD PE=3 SV=1 99 486 4.0E-175
sp|B3R3X0|NUOD_CUPTR NADH-quinone oxidoreductase subunit D OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=nuoD PE=3 SV=1 100 486 7.0E-175
sp|Q1LPW0|NUOD_CUPMC NADH-quinone oxidoreductase subunit D OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=nuoD PE=3 SV=1 100 486 8.0E-175
sp|Q3BRN2|NUOD_XANC5 NADH-quinone oxidoreductase subunit D OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=nuoD PE=3 SV=1 91 486 2.0E-174
sp|Q0C1E4|NUOD_HYPNA NADH-quinone oxidoreductase subunit D OS=Hyphomonas neptunium (strain ATCC 15444) GN=nuoD PE=3 SV=1 101 486 2.0E-174
sp|Q21YC4|NUOD_RHOFT NADH-quinone oxidoreductase subunit D OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=nuoD PE=3 SV=1 99 486 2.0E-174
sp|A5IHW0|NUOD_LEGPC NADH-quinone oxidoreductase subunit D OS=Legionella pneumophila (strain Corby) GN=nuoD PE=3 SV=1 99 486 2.0E-174
sp|Q5X1B0|NUOD_LEGPA NADH-quinone oxidoreductase subunit D OS=Legionella pneumophila (strain Paris) GN=nuoD PE=3 SV=1 99 486 2.0E-174
sp|Q5GXT4|NUOD_XANOR NADH-quinone oxidoreductase subunit D OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=nuoD PE=3 SV=1 85 486 3.0E-174
sp|B2SVL6|NUOD_XANOP NADH-quinone oxidoreductase subunit D OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=nuoD PE=3 SV=1 85 486 3.0E-174
sp|Q2P0V8|NUOD_XANOM NADH-quinone oxidoreductase subunit D OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=nuoD PE=3 SV=1 85 486 3.0E-174
sp|Q8PJ43|NUOD_XANAC NADH-quinone oxidoreductase subunit D OS=Xanthomonas axonopodis pv. citri (strain 306) GN=nuoD PE=3 SV=1 91 486 5.0E-174
sp|Q2NA64|NUOD_ERYLH NADH-quinone oxidoreductase subunit D OS=Erythrobacter litoralis (strain HTCC2594) GN=nuoD PE=3 SV=1 100 486 2.0E-173
sp|A9BNB1|NUOD_DELAS NADH-quinone oxidoreductase subunit D OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=nuoD PE=3 SV=1 99 486 3.0E-173
sp|Q8P7T5|NUOD_XANCP NADH-quinone oxidoreductase subunit D OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=nuoD PE=3 SV=1 91 486 3.0E-173
sp|B0RRA1|NUOD_XANCB NADH-quinone oxidoreductase subunit D OS=Xanthomonas campestris pv. campestris (strain B100) GN=nuoD PE=3 SV=1 91 486 3.0E-173
sp|Q4UWB5|NUOD_XANC8 NADH-quinone oxidoreductase subunit D OS=Xanthomonas campestris pv. campestris (strain 8004) GN=nuoD PE=3 SV=1 91 486 3.0E-173
sp|B2IHW4|NUOD1_BEII9 NADH-quinone oxidoreductase subunit D 1 OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=nuoD1 PE=3 SV=1 100 486 3.0E-173
sp|Q3J831|NUOD_NITOC NADH-quinone oxidoreductase subunit D OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=nuoD PE=3 SV=1 99 486 4.0E-173
sp|B5EN68|NUOD_ACIF5 NADH-quinone oxidoreductase subunit D OS=Acidithiobacillus ferrooxidans (strain ATCC 53993) GN=nuoD PE=3 SV=1 99 486 7.0E-173
sp|Q0KCS7|NUOD_CUPNH NADH-quinone oxidoreductase subunit D OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=nuoD PE=3 SV=1 100 486 7.0E-173
sp|B6IZ48|NUOD_COXB2 NADH-quinone oxidoreductase subunit D OS=Coxiella burnetii (strain CbuG_Q212) GN=nuoD PE=3 SV=1 99 486 2.0E-172
sp|B6J697|NUOD_COXB1 NADH-quinone oxidoreductase subunit D OS=Coxiella burnetii (strain CbuK_Q154) GN=nuoD PE=3 SV=1 99 486 2.0E-172
sp|Q473U0|NUOD_CUPPJ NADH-quinone oxidoreductase subunit D OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=nuoD PE=3 SV=1 100 486 2.0E-172
sp|B1XUK1|NUOD_POLNS NADH-quinone oxidoreductase subunit D OS=Polynucleobacter necessarius subsp. necessarius (strain STIR1) GN=nuoD PE=3 SV=1 99 486 2.0E-172
sp|A9KBK7|NUOD_COXBN NADH-quinone oxidoreductase subunit D OS=Coxiella burnetii (strain Dugway 5J108-111) GN=nuoD PE=3 SV=3 99 486 3.0E-172
sp|Q83BQ8|NUOD_COXBU NADH-quinone oxidoreductase subunit D OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=nuoD PE=3 SV=1 99 486 9.0E-172
sp|A9N8X0|NUOD_COXBR NADH-quinone oxidoreductase subunit D OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=nuoD PE=3 SV=1 99 486 9.0E-172
sp|Q23883|NDUS2_DICDI NADH-ubiquinone oxidoreductase 49 kDa subunit OS=Dictyostelium discoideum GN=nad7 PE=1 SV=1 96 486 1.0E-171
sp|Q2LCR5|NDUS2_DICCI NADH-ubiquinone oxidoreductase 49 kDa subunit OS=Dictyostelium citrinum GN=nad7 PE=3 SV=1 96 486 2.0E-171
sp|O07310|NUOD_RHOCA NADH-quinone oxidoreductase subunit D OS=Rhodobacter capsulatus GN=nuoD PE=3 SV=2 98 486 3.0E-171
sp|A1AVR5|NUOD_RUTMC NADH-quinone oxidoreductase subunit D OS=Ruthia magnifica subsp. Calyptogena magnifica GN=nuoD PE=3 SV=1 99 486 1.0E-170
sp|A5CXG0|NUOD_VESOH NADH-quinone oxidoreductase subunit D OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=nuoD PE=3 SV=1 99 486 2.0E-170
sp|Q47HH3|NUOD_DECAR NADH-quinone oxidoreductase subunit D OS=Dechloromonas aromatica (strain RCB) GN=nuoD PE=3 SV=1 100 486 2.0E-170
sp|B0TWP7|NUOD_FRAP2 NADH-quinone oxidoreductase subunit D OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=nuoD PE=3 SV=1 101 486 4.0E-166
sp|A1WXW4|NUOD_HALHL NADH-quinone oxidoreductase subunit D OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=nuoD PE=3 SV=1 99 486 5.0E-165
sp|A0Q8G9|NUOD_FRATN NADH-quinone oxidoreductase subunit D OS=Francisella tularensis subsp. novicida (strain U112) GN=nuoD PE=3 SV=1 101 486 5.0E-165
sp|A4IVZ5|NUOD_FRATW NADH-quinone oxidoreductase subunit D OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=nuoD PE=3 SV=1 101 486 7.0E-164
sp|B2SEV2|NUOD_FRATM NADH-quinone oxidoreductase subunit D OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=nuoD PE=3 SV=1 101 486 7.0E-164
sp|Q5NIN2|NUOD_FRATT NADH-quinone oxidoreductase subunit D OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=nuoD PE=3 SV=1 101 486 2.0E-163
sp|Q14K35|NUOD_FRAT1 NADH-quinone oxidoreductase subunit D OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=nuoD PE=3 SV=1 101 486 2.0E-163
sp|Q0BK54|NUOD_FRATO NADH-quinone oxidoreductase subunit D OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=nuoD PE=3 SV=1 101 486 4.0E-163
sp|Q2A1F3|NUOD_FRATH NADH-quinone oxidoreductase subunit D OS=Francisella tularensis subsp. holarctica (strain LVS) GN=nuoD PE=3 SV=1 101 486 4.0E-163
sp|A7NEK7|NUOD_FRATF NADH-quinone oxidoreductase subunit D OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=nuoD PE=3 SV=1 101 486 4.0E-163
sp|A5G9B6|NUOD_GEOUR NADH-quinone oxidoreductase subunit D OS=Geobacter uraniireducens (strain Rf4) GN=nuoD PE=3 SV=1 104 486 9.0E-137
sp|B5YL34|NUOD2_THEYD NADH-quinone oxidoreductase subunit D 2 OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=nuoD2 PE=3 SV=1 92 486 1.0E-135
sp|Q74GA5|NUOD_GEOSL NADH-quinone oxidoreductase subunit D OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=nuoD PE=3 SV=1 104 486 9.0E-135
sp|P56908|NUOD2_RHIME NADH-quinone oxidoreductase subunit D 2 OS=Rhizobium meliloti (strain 1021) GN=nuoD2 PE=3 SV=2 96 486 7.0E-134
sp|A6UFK4|NUOD2_SINMW NADH-quinone oxidoreductase subunit D 2 OS=Sinorhizobium medicae (strain WSM419) GN=nuoD2 PE=3 SV=1 96 486 7.0E-134
sp|Q39QB0|NUOD_GEOMG NADH-quinone oxidoreductase subunit D OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=nuoD PE=3 SV=1 104 486 1.0E-133
sp|B5YKI5|NUOD1_THEYD NADH-quinone oxidoreductase subunit D 1 OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=nuoD1 PE=3 SV=1 98 486 1.0E-133
sp|Q1IS35|NUOD2_KORVE NADH-quinone oxidoreductase subunit D 2 OS=Koribacter versatilis (strain Ellin345) GN=nuoD2 PE=3 SV=1 95 486 2.0E-133
sp|B5EFG0|NUOD_GEOBB NADH-quinone oxidoreductase subunit D OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=nuoD PE=3 SV=1 104 486 1.0E-132
sp|B3E9W6|NUOD_GEOLS NADH-quinone oxidoreductase subunit D OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=nuoD PE=3 SV=1 104 486 3.0E-132
sp|A9WFB4|NUOD2_CHLAA NADH-quinone oxidoreductase subunit D 2 OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=nuoD2 PE=3 SV=1 104 486 4.0E-132
sp|Q2K3U2|NUOD2_RHIEC NADH-quinone oxidoreductase subunit D 2 OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=nuoD2 PE=3 SV=1 96 486 1.0E-131
sp|A9B4Z7|NUOD1_HERA2 NADH-quinone oxidoreductase subunit D 1 OS=Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785) GN=nuoD1 PE=3 SV=1 65 486 3.0E-131
sp|B3PY59|NUOD2_RHIE6 NADH-quinone oxidoreductase subunit D 2 OS=Rhizobium etli (strain CIAT 652) GN=nuoD2 PE=3 SV=1 96 486 3.0E-130
sp|A5UZH7|NUOD2_ROSS1 NADH-quinone oxidoreductase subunit D 2 OS=Roseiflexus sp. (strain RS-1) GN=nuoD2 PE=3 SV=1 81 486 3.0E-128
sp|A7NIV9|NUOD1_ROSCS NADH-quinone oxidoreductase subunit D 1 OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=nuoD1 PE=3 SV=1 105 486 8.0E-127
sp|P15689|NDUS2_PARTE NADH-ubiquinone oxidoreductase 49 kDa subunit OS=Paramecium tetraurelia GN=NAD7 PE=3 SV=1 105 486 2.0E-125
sp|B3DXN7|NUOD_METI4 NADH-quinone oxidoreductase subunit D OS=Methylacidiphilum infernorum (isolate V4) GN=nuoD PE=3 SV=1 105 486 3.0E-124
sp|A0LRI4|NUOD_ACIC1 NADH-quinone oxidoreductase subunit D OS=Acidothermus cellulolyticus (strain ATCC 43068 / 11B) GN=nuoD PE=3 SV=1 93 486 8.0E-124
sp|B2ULZ0|NUOD_AKKM8 NADH-quinone oxidoreductase subunit D OS=Akkermansia muciniphila (strain ATCC BAA-835 / Muc) GN=nuoD PE=3 SV=1 104 486 2.0E-123
sp|Q1D8S7|NUOD_MYXXD NADH-quinone oxidoreductase subunit D OS=Myxococcus xanthus (strain DK 1622) GN=nuoD PE=3 SV=1 97 486 4.0E-123
sp|Q02CU0|NUOD1_SOLUE NADH-quinone oxidoreductase subunit D 1 OS=Solibacter usitatus (strain Ellin6076) GN=nuoD1 PE=3 SV=1 101 486 2.0E-122
sp|Q2S5J0|NUOD_SALRD NADH-quinone oxidoreductase subunit D OS=Salinibacter ruber (strain DSM 13855 / M31) GN=nuoD PE=3 SV=1 83 486 6.0E-120
sp|B3QUS0|NUOD1_CHLT3 NADH-quinone oxidoreductase subunit D 1 OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) GN=nuoD1 PE=3 SV=1 104 486 1.0E-119
sp|Q1IS59|NUOD1_KORVE NADH-quinone oxidoreductase subunit D 1 OS=Koribacter versatilis (strain Ellin345) GN=nuoD1 PE=3 SV=1 104 486 2.0E-119
sp|Q0S447|NUOD_RHOJR NADH-quinone oxidoreductase subunit D OS=Rhodococcus jostii (strain RHA1) GN=nuoD PE=3 SV=1 105 486 3.0E-119
sp|Q72GD1|NUOD_THET2 NADH-quinone oxidoreductase subunit D OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=nuoD PE=3 SV=1 104 486 5.0E-119
sp|Q56220|NQO4_THET8 NADH-quinone oxidoreductase subunit 4 OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=nqo4 PE=1 SV=1 104 486 1.0E-118
sp|Q82DX8|NUOD1_STRAW NADH-quinone oxidoreductase subunit D 1 OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=nuoD1 PE=3 SV=1 105 486 3.0E-118
sp|Q7MA48|NUOD_WOLSU NADH-quinone oxidoreductase subunit D OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=nuoD PE=3 SV=1 92 486 4.0E-118
sp|A4FPT8|NUOD_SACEN NADH-quinone oxidoreductase subunit D OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=nuoD PE=3 SV=1 92 486 5.0E-117
sp|Q01UN9|NUOD2_SOLUE NADH-quinone oxidoreductase subunit D 2 OS=Solibacter usitatus (strain Ellin6076) GN=nuoD2 PE=3 SV=1 104 486 8.0E-117
sp|A8Z6E5|NUOD_CAMC1 NADH-quinone oxidoreductase subunit D OS=Campylobacter concisus (strain 13826) GN=nuoD PE=3 SV=1 105 486 4.0E-116
sp|Q47LE7|NUOD_THEFY NADH-quinone oxidoreductase subunit D OS=Thermobifida fusca (strain YX) GN=nuoD PE=3 SV=1 71 486 5.0E-116
sp|A8M619|NUOD1_SALAI NADH-quinone oxidoreductase subunit D 1 OS=Salinispora arenicola (strain CNS-205) GN=nuoD1 PE=3 SV=1 104 486 2.0E-115
sp|Q9XAQ7|NUOD2_STRCO NADH-quinone oxidoreductase subunit D 2 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=nuoD2 PE=3 SV=1 105 486 3.0E-115
sp|A4J657|NUOD_DESRM NADH-quinone oxidoreductase subunit D OS=Desulfotomaculum reducens (strain MI-1) GN=nuoD PE=3 SV=1 99 485 1.0E-114
sp|A5GCZ4|NUBCD_GEOUR NADH-quinone oxidoreductase subunit B/C/D OS=Geobacter uraniireducens (strain Rf4) GN=nuoBCD PE=3 SV=1 105 486 2.0E-114
sp|A8LC98|NUOD_FRASN NADH-quinone oxidoreductase subunit D OS=Frankia sp. (strain EAN1pec) GN=nuoD PE=3 SV=1 104 486 2.0E-114
sp|Q5YWD0|NUOD_NOCFA NADH-quinone oxidoreductase subunit D OS=Nocardia farcinica (strain IFM 10152) GN=nuoD PE=3 SV=1 105 486 3.0E-114
sp|O67335|NUCD2_AQUAE NADH-quinone oxidoreductase subunit C/D 2 OS=Aquifex aeolicus (strain VF5) GN=nuoC2 PE=3 SV=1 81 486 3.0E-114
sp|A7HZV1|NUOD_CAMHC NADH-quinone oxidoreductase subunit D OS=Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 / CH001A) GN=nuoD PE=3 SV=1 92 486 8.0E-114
sp|A6QCG0|NUOD_SULNB NADH-quinone oxidoreductase subunit D OS=Sulfurovum sp. (strain NBC37-1) GN=nuoD PE=3 SV=1 92 486 9.0E-114
sp|A7H9V5|NUOD2_ANADF NADH-quinone oxidoreductase subunit D 2 OS=Anaeromyxobacter sp. (strain Fw109-5) GN=nuoD2 PE=3 SV=1 104 486 1.0E-113
sp|A4XC35|NUOD1_SALTO NADH-quinone oxidoreductase subunit D 1 OS=Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / CNB-440) GN=nuoD1 PE=3 SV=1 104 486 2.0E-113
sp|Q0RRW5|NUOD_FRAAA NADH-quinone oxidoreductase subunit D OS=Frankia alni (strain ACN14a) GN=nuoD PE=3 SV=1 105 486 2.0E-113
sp|A7GW67|NUOD_CAMC5 NADH-quinone oxidoreductase subunit D OS=Campylobacter curvus (strain 525.92) GN=nuoD PE=3 SV=1 92 486 2.0E-113
sp|B1ZRT0|NUOD1_OPITP NADH-quinone oxidoreductase subunit D 1 OS=Opitutus terrae (strain DSM 11246 / PB90-1) GN=nuoD1 PE=3 SV=1 104 486 2.0E-113
sp|A1W1H5|NUOD_CAMJJ NADH-quinone oxidoreductase subunit D OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=nuoD PE=3 SV=1 81 486 3.0E-113
sp|Q6MIR5|NUOCD_BDEBA NADH-quinone oxidoreductase subunit C/D OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=nuoC PE=3 SV=1 101 486 4.0E-113
sp|Q2IL06|NUOD1_ANADE NADH-quinone oxidoreductase subunit D 1 OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=nuoD1 PE=3 SV=2 101 486 5.0E-113
sp|B4UIA9|NUOD2_ANASK NADH-quinone oxidoreductase subunit D 2 OS=Anaeromyxobacter sp. (strain K) GN=nuoD2 PE=3 SV=1 101 486 5.0E-113
sp|A6Q1P6|NUOD_NITSB NADH-quinone oxidoreductase subunit D OS=Nitratiruptor sp. (strain SB155-2) GN=nuoD PE=3 SV=1 92 486 6.0E-113
sp|Q608X9|NUOCD_METCA NADH-quinone oxidoreductase subunit C/D OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=nuoC PE=3 SV=1 105 486 2.0E-112
sp|A7H5S8|NUOD_CAMJD NADH-quinone oxidoreductase subunit D OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=nuoD PE=3 SV=1 81 486 3.0E-112
sp|A8FNN4|NUOD_CAMJ8 NADH-quinone oxidoreductase subunit D OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=nuoD PE=3 SV=1 81 486 4.0E-112
sp|Q5HSL5|NUOD_CAMJR NADH-quinone oxidoreductase subunit D OS=Campylobacter jejuni (strain RM1221) GN=nuoD PE=3 SV=1 81 486 4.0E-112
sp|Q9PM99|NUOD_CAMJE NADH-quinone oxidoreductase subunit D OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=nuoD PE=3 SV=1 81 486 4.0E-112
sp|A9GUZ1|NUOD1_SORC5 NADH-quinone oxidoreductase subunit D 1 OS=Sorangium cellulosum (strain So ce56) GN=nuoD1 PE=3 SV=1 105 485 5.0E-112
sp|A9WED7|NUOD1_CHLAA NADH-quinone oxidoreductase subunit D 1 OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=nuoD1 PE=3 SV=1 99 486 7.0E-112
sp|Q2JFL7|NUOD_FRASC NADH-quinone oxidoreductase subunit D OS=Frankia sp. (strain CcI3) GN=nuoD PE=3 SV=1 105 486 5.0E-111
sp|Q3A825|NUBCD_PELCD NADH-quinone oxidoreductase subunit B/C/D OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=nuoBCD PE=3 SV=1 105 486 1.0E-110
sp|Q1CRZ8|NUOD_HELPH NADH-quinone oxidoreductase subunit D OS=Helicobacter pylori (strain HPAG1) GN=nuoD PE=3 SV=1 90 486 1.0E-110
sp|O25853|NUOD_HELPY NADH-quinone oxidoreductase subunit D OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=nuoD PE=3 SV=1 90 486 1.0E-110
sp|Q9ZJW4|NUOD_HELPJ NADH-quinone oxidoreductase subunit D OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=nuoD PE=3 SV=1 90 486 2.0E-110
sp|B6JNA3|NUOD_HELP2 NADH-quinone oxidoreductase subunit D OS=Helicobacter pylori (strain P12) GN=nuoD PE=3 SV=1 90 486 2.0E-110
sp|B5Z8Q8|NUOD_HELPG NADH-quinone oxidoreductase subunit D OS=Helicobacter pylori (strain G27) GN=nuoD PE=3 SV=1 90 486 2.0E-110
sp|B2UV27|NUOD_HELPS NADH-quinone oxidoreductase subunit D OS=Helicobacter pylori (strain Shi470) GN=nuoD PE=3 SV=1 90 486 2.0E-110
sp|B1W516|NUOD1_STRGG NADH-quinone oxidoreductase subunit D 1 OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=nuoD1 PE=3 SV=1 105 486 2.0E-110
sp|A5UXK3|NUOD1_ROSS1 NADH-quinone oxidoreductase subunit D 1 OS=Roseiflexus sp. (strain RS-1) GN=nuoD1 PE=3 SV=1 99 486 3.0E-110
sp|A1ALP2|NUOD_PELPD NADH-quinone oxidoreductase subunit D OS=Pelobacter propionicus (strain DSM 2379) GN=nuoD1 PE=3 SV=1 101 486 3.0E-110
sp|A4TDA8|NUOD_MYCGI NADH-quinone oxidoreductase subunit D OS=Mycobacterium gilvum (strain PYR-GCK) GN=nuoD PE=3 SV=1 62 486 4.0E-110
sp|P9WJH5|NUOD_MYCTU NADH-quinone oxidoreductase subunit D OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=nuoD PE=1 SV=1 104 486 4.0E-110
sp|P9WJH4|NUOD_MYCTO NADH-quinone oxidoreductase subunit D OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=nuoD PE=3 SV=1 104 486 4.0E-110
sp|A5U7G4|NUOD_MYCTA NADH-quinone oxidoreductase subunit D OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=nuoD PE=3 SV=1 104 486 4.0E-110
sp|A1KNE4|NUOD_MYCBP NADH-quinone oxidoreductase subunit D OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=nuoD PE=3 SV=1 104 486 4.0E-110
sp|P65570|NUOD_MYCBO NADH-quinone oxidoreductase subunit D OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=nuoD PE=3 SV=1 104 486 4.0E-110
sp|Q746S4|NUBCD_GEOSL NADH-quinone oxidoreductase subunit B/C/D OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=nuoBCD PE=3 SV=1 105 486 7.0E-110
sp|Q17Z55|NUOD_HELAH NADH-quinone oxidoreductase subunit D OS=Helicobacter acinonychis (strain Sheeba) GN=nuoD PE=3 SV=1 90 486 9.0E-110
sp|B0TH80|NUOD_HELMI NADH-quinone oxidoreductase subunit D OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=nuoD PE=3 SV=1 99 485 1.0E-109
sp|A1SE30|NUOD_NOCSJ NADH-quinone oxidoreductase subunit D OS=Nocardioides sp. (strain BAA-499 / JS614) GN=nuoD PE=3 SV=1 70 486 2.0E-109
sp|Q73V12|NUOD_MYCPA NADH-quinone oxidoreductase subunit D OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=nuoD PE=3 SV=1 105 486 2.0E-109
sp|A0QJV0|NUOD_MYCA1 NADH-quinone oxidoreductase subunit D OS=Mycobacterium avium (strain 104) GN=nuoD PE=3 SV=1 105 486 2.0E-109
sp|A9HN95|NUOCD_GLUDA NADH-quinone oxidoreductase subunit C/D OS=Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / PAl5) GN=nuoC PE=3 SV=1 105 486 3.0E-109
sp|Q1BBP6|NUOD_MYCSS NADH-quinone oxidoreductase subunit D OS=Mycobacterium sp. (strain MCS) GN=nuoD PE=3 SV=1 104 486 3.0E-109
sp|A1UDA1|NUOD_MYCSK NADH-quinone oxidoreductase subunit D OS=Mycobacterium sp. (strain KMS) GN=nuoD PE=3 SV=1 104 486 3.0E-109
sp|A3PWR8|NUOD_MYCSJ NADH-quinone oxidoreductase subunit D OS=Mycobacterium sp. (strain JLS) GN=nuoD PE=3 SV=1 104 486 3.0E-109
sp|A7NL07|NUOD2_ROSCS NADH-quinone oxidoreductase subunit D 2 OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=nuoD2 PE=3 SV=1 99 486 6.0E-109
sp|Q6MDR3|NUOD_PARUW NADH-quinone oxidoreductase subunit D OS=Protochlamydia amoebophila (strain UWE25) GN=nuoD PE=3 SV=1 105 486 1.0E-108
sp|Q2YAA3|NUOCD_NITMU NADH-quinone oxidoreductase subunit C/D OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=nuoC PE=3 SV=1 105 486 1.0E-108
sp|Q39ZC4|NUBCD_GEOMG NADH-quinone oxidoreductase subunit B/C/D OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=nuoBCD PE=3 SV=1 105 486 1.0E-108
sp|A1T6A3|NUOD_MYCVP NADH-quinone oxidoreductase subunit D OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=nuoD PE=3 SV=1 62 486 3.0E-108
sp|Q3JC17|NUOCD_NITOC NADH-quinone oxidoreductase subunit C/D OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=nuoC PE=3 SV=1 105 486 3.0E-108
sp|Q1IZX0|NUOD_DEIGD NADH-quinone oxidoreductase subunit D OS=Deinococcus geothermalis (strain DSM 11300) GN=nuoD PE=3 SV=1 104 486 3.0E-108
sp|A0QU33|NUOD_MYCS2 NADH-quinone oxidoreductase subunit D OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=nuoD PE=3 SV=1 104 486 4.0E-108
sp|B4U8I3|NUOCD_HYDS0 NADH-quinone oxidoreductase subunit C/D OS=Hydrogenobaculum sp. (strain Y04AAS1) GN=nuoC PE=3 SV=1 98 486 6.0E-108
sp|B1MPG7|NUOD_MYCA9 NADH-quinone oxidoreductase subunit D OS=Mycobacterium abscessus (strain ATCC 19977 / DSM 44196 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543) GN=nuoD PE=3 SV=1 104 486 6.0E-108
sp|A0PR41|NUOD_MYCUA NADH-quinone oxidoreductase subunit D OS=Mycobacterium ulcerans (strain Agy99) GN=nuoD PE=3 SV=1 104 486 2.0E-107
sp|A5FXJ8|NUOCD_ACICJ NADH-quinone oxidoreductase subunit C/D OS=Acidiphilium cryptum (strain JF-5) GN=nuoC PE=3 SV=1 84 486 2.0E-107
sp|B2HGE5|NUOD_MYCMM NADH-quinone oxidoreductase subunit D OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=nuoD PE=3 SV=1 105 486 2.0E-107
sp|Q30PI1|NUOD_SULDN NADH-quinone oxidoreductase subunit D OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=nuoD PE=3 SV=1 92 486 3.0E-107
sp|A4ITI4|NUOD_GEOTN NADH-quinone oxidoreductase subunit D OS=Geobacillus thermodenitrificans (strain NG80-2) GN=nuoD PE=3 SV=1 99 485 8.0E-107
sp|O66826|NUCD1_AQUAE NADH-quinone oxidoreductase subunit C/D 1 OS=Aquifex aeolicus (strain VF5) GN=nuoC1 PE=3 SV=1 98 486 2.0E-106
sp|Q67KN9|NUOD2_SYMTH NADH-quinone oxidoreductase subunit D 2 OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=nuoD2 PE=3 SV=1 99 486 3.0E-106
sp|Q7VFS5|NUOD_HELHP NADH-quinone oxidoreductase subunit D OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=nuoD PE=3 SV=1 88 486 4.0E-106
sp|Q3Z7Z8|NUOD_DEHM1 NADH-quinone oxidoreductase subunit D OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=nuoD PE=3 SV=1 99 486 5.0E-106
sp|Q5KUJ8|NUOD_GEOKA NADH-quinone oxidoreductase subunit D OS=Geobacillus kaustophilus (strain HTA426) GN=nuoD PE=3 SV=1 99 485 6.0E-106
sp|Q9RU89|NUOD_DEIRA NADH-quinone oxidoreductase subunit D OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=nuoD PE=3 SV=1 104 486 6.0E-106
sp|B4EZC8|NUOCD_PROMH NADH-quinone oxidoreductase subunit C/D OS=Proteus mirabilis (strain HI4320) GN=nuoC PE=3 SV=1 105 486 3.0E-105
sp|A5FQY6|NUOD_DEHMB NADH-quinone oxidoreductase subunit D OS=Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1) GN=nuoD PE=3 SV=1 99 486 4.0E-105
sp|B1X4A5|NDHH_PAUCH NAD(P)H-quinone oxidoreductase subunit H, organellar chromatophore OS=Paulinella chromatophora GN=ndhH PE=3 SV=1 105 486 4.0E-105
sp|B5E972|NUBCD_GEOBB NADH-quinone oxidoreductase subunit B/C/D OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=nuoBCD PE=3 SV=1 105 486 2.0E-104
sp|Q07QX3|NUOCD_RHOP5 NADH-quinone oxidoreductase subunit C/D OS=Rhodopseudomonas palustris (strain BisA53) GN=nuoC PE=3 SV=1 95 486 4.0E-104
sp|Q3ZXR8|NUOD_DEHMC NADH-quinone oxidoreductase subunit D OS=Dehalococcoides mccartyi (strain CBDB1) GN=nuoD PE=3 SV=1 99 486 7.0E-104
sp|B1KJV0|NUOCD_SHEWM NADH-quinone oxidoreductase subunit C/D OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=nuoC PE=3 SV=1 105 486 9.0E-104
sp|A4WCR5|NUOCD_ENT38 NADH-quinone oxidoreductase subunit C/D OS=Enterobacter sp. (strain 638) GN=nuoC PE=3 SV=1 105 486 3.0E-103
sp|A1JLG6|NUOCD_YERE8 NADH-quinone oxidoreductase subunit C/D OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=nuoC PE=3 SV=1 105 486 3.0E-103
sp|Q7VRV4|NUOCD_BLOFL NADH-quinone oxidoreductase subunit C/D OS=Blochmannia floridanus GN=nuoC PE=3 SV=1 97 486 6.0E-103
sp|A7GV48|NUOD_BACCN NADH-quinone oxidoreductase subunit D OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=nuoD PE=3 SV=1 105 485 7.0E-103
sp|Q1LT91|NUOCD_BAUCH NADH-quinone oxidoreductase subunit C/D OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=nuoC PE=3 SV=1 105 486 1.0E-102
sp|A4XV04|NUOCD_PSEMY NADH-quinone oxidoreductase subunit C/D OS=Pseudomonas mendocina (strain ymp) GN=nuoC PE=3 SV=1 67 486 1.0E-102
sp|Q7N2I9|NUOCD_PHOLL NADH-quinone oxidoreductase subunit C/D OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=nuoC PE=3 SV=1 105 486 1.0E-102
sp|Q8M9T5|NDHH_CHAGL NAD(P)H-quinone oxidoreductase subunit H, chloroplastic OS=Chaetosphaeridium globosum GN=ndhH PE=3 SV=1 98 486 1.0E-102
sp|A9VS95|NUOD_BACWK NADH-quinone oxidoreductase subunit D OS=Bacillus weihenstephanensis (strain KBAB4) GN=nuoD PE=3 SV=1 105 485 1.0E-102
sp|Q6N1Z0|NUOCD_RHOPA NADH-quinone oxidoreductase subunit C/D OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=nuoC PE=3 SV=1 105 486 1.0E-102
sp|B3Q6T3|NUOCD_RHOPT NADH-quinone oxidoreductase subunit C/D OS=Rhodopseudomonas palustris (strain TIE-1) GN=nuoC PE=3 SV=1 105 486 2.0E-102
sp|Q2J0F1|NUOCD_RHOP2 NADH-quinone oxidoreductase subunit C/D OS=Rhodopseudomonas palustris (strain HaA2) GN=nuoC PE=3 SV=1 105 486 3.0E-102
sp|A0LEQ1|NUOD_SYNFM NADH-quinone oxidoreductase subunit D OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=nuoD PE=3 SV=1 103 486 4.0E-102
sp|Q13BH3|NUOCD_RHOPS NADH-quinone oxidoreductase subunit C/D OS=Rhodopseudomonas palustris (strain BisB5) GN=nuoC PE=3 SV=1 105 486 4.0E-102
sp|A9R6L8|NUOCD_YERPG NADH-quinone oxidoreductase subunit C/D OS=Yersinia pestis bv. Antiqua (strain Angola) GN=nuoC PE=3 SV=1 105 486 4.0E-102
sp|Q3J1Q7|NUOCD_RHOS4 NADH-quinone oxidoreductase subunit C/D OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=nuoC PE=3 SV=1 105 486 6.0E-102
sp|B1JGL5|NUOCD_YERPY NADH-quinone oxidoreductase subunit C/D OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=nuoC PE=3 SV=1 105 486 7.0E-102
sp|Q669A2|NUOCD_YERPS NADH-quinone oxidoreductase subunit C/D OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=nuoC PE=3 SV=1 105 486 7.0E-102
sp|A4TM34|NUOCD_YERPP NADH-quinone oxidoreductase subunit C/D OS=Yersinia pestis (strain Pestoides F) GN=nuoC PE=3 SV=1 105 486 7.0E-102
sp|Q1CHQ3|NUOCD_YERPN NADH-quinone oxidoreductase subunit C/D OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=nuoC PE=3 SV=1 105 486 7.0E-102
sp|Q7CJ92|NUOCD_YERPE NADH-quinone oxidoreductase subunit C/D OS=Yersinia pestis GN=nuoC PE=3 SV=1 105 486 7.0E-102
sp|B2K819|NUOCD_YERPB NADH-quinone oxidoreductase subunit C/D OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=nuoC PE=3 SV=1 105 486 7.0E-102
sp|Q1C6B1|NUOCD_YERPA NADH-quinone oxidoreductase subunit C/D OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=nuoC PE=3 SV=1 105 486 7.0E-102
sp|A7FGQ7|NUOCD_YERP3 NADH-quinone oxidoreductase subunit C/D OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=nuoC PE=3 SV=1 105 486 7.0E-102
sp|Q81K03|NUOD_BACAN NADH-quinone oxidoreductase subunit D OS=Bacillus anthracis GN=nuoD PE=3 SV=1 105 485 7.0E-102
sp|Q814W9|NUOD_BACCR NADH-quinone oxidoreductase subunit D OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=nuoD PE=3 SV=1 105 485 8.0E-102
sp|B9KJI1|NUOCD_RHOSK NADH-quinone oxidoreductase subunit C/D OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=nuoC PE=3 SV=1 105 486 1.0E-101
sp|A9B480|NUOD2_HERA2 NADH-quinone oxidoreductase subunit D 2 OS=Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785) GN=nuoD2 PE=3 SV=1 99 486 1.0E-101
sp|A3PKI2|NUOCD_RHOS1 NADH-quinone oxidoreductase subunit C/D OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=nuoC PE=3 SV=1 105 486 1.0E-101
sp|Q9I0J9|NUOCD_PSEAE NADH-quinone oxidoreductase subunit C/D OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=nuoC PE=3 SV=1 105 486 3.0E-101
sp|Q02ND1|NUOCD_PSEAB NADH-quinone oxidoreductase subunit C/D OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=nuoC PE=3 SV=1 105 486 3.0E-101
sp|A6V4E7|NUOCD_PSEA7 NADH-quinone oxidoreductase subunit C/D OS=Pseudomonas aeruginosa (strain PA7) GN=nuoC PE=3 SV=1 105 486 3.0E-101
sp|A0RL88|NUOD_BACAH NADH-quinone oxidoreductase subunit D OS=Bacillus thuringiensis (strain Al Hakam) GN=nuoD PE=3 SV=1 105 485 3.0E-101
sp|Q8KEC0|NUOD_CHLTE NADH-quinone oxidoreductase subunit D OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=nuoD PE=3 SV=2 102 486 3.0E-101
sp|Q20Z41|NUOCD_RHOPB NADH-quinone oxidoreductase subunit C/D OS=Rhodopseudomonas palustris (strain BisB18) GN=nuoC PE=3 SV=1 105 486 3.0E-101
sp|Q3AC80|NUOD_CARHZ NADH-quinone oxidoreductase subunit D OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=nuoD PE=3 SV=1 99 485 5.0E-101
sp|B0SP85|NUOD_LEPBP NADH-quinone oxidoreductase subunit D OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris) GN=nuoD PE=3 SV=1 102 485 6.0E-101
sp|B0SFT7|NUOD_LEPBA NADH-quinone oxidoreductase subunit D OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames) GN=nuoD PE=3 SV=1 102 485 6.0E-101
sp|A0KJ65|NUOCD_AERHH NADH-quinone oxidoreductase subunit C/D OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=nuoC PE=3 SV=1 105 486 6.0E-101
sp|B3QP55|NUOD_CHLP8 NADH-quinone oxidoreductase subunit D OS=Chlorobaculum parvum (strain NCIB 8327) GN=nuoD PE=3 SV=1 102 486 6.0E-101
sp|Q8F7Q2|NUOD_LEPIN NADH-quinone oxidoreductase subunit D OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=nuoD PE=3 SV=1 102 485 7.0E-101
sp|Q72NT5|NUOD_LEPIC NADH-quinone oxidoreductase subunit D OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=nuoD PE=3 SV=1 102 485 7.0E-101
sp|C5B8I4|NUOCD_EDWI9 NADH-quinone oxidoreductase subunit C/D OS=Edwardsiella ictaluri (strain 93-146) GN=nuoC PE=3 SV=1 105 486 7.0E-101
sp|C3JY83|NUOCD_PSEFS NADH-quinone oxidoreductase subunit C/D OS=Pseudomonas fluorescens (strain SBW25) GN=nuoC PE=3 SV=1 105 486 7.0E-101
sp|A7MH24|NUOCD_CROS8 NADH-quinone oxidoreductase subunit C/D OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=nuoC PE=3 SV=1 105 486 1.0E-100
sp|Q6HAY8|NUOD_BACHK NADH-quinone oxidoreductase subunit D OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=nuoD PE=3 SV=1 105 485 2.0E-100
sp|C6DA44|NUOCD_PECCP NADH-quinone oxidoreductase subunit C/D OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=nuoC PE=3 SV=1 105 486 2.0E-100
sp|A8GH14|NUOCD_SERP5 NADH-quinone oxidoreductase subunit C/D OS=Serratia proteamaculans (strain 568) GN=nuoC PE=3 SV=1 105 486 2.0E-100
sp|Q4K9T4|NUOCD_PSEF5 NADH-quinone oxidoreductase subunit C/D OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=nuoC PE=3 SV=1 105 486 2.0E-100
sp|Q72XF6|NUOD_BACC1 NADH-quinone oxidoreductase subunit D OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=nuoD PE=3 SV=1 105 485 3.0E-100
sp|A6LXQ2|NUOD_CLOB8 NADH-quinone oxidoreductase subunit D OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=nuoD PE=3 SV=1 104 486 3.0E-100
sp|A8ADV3|NUOCD_CITK8 NADH-quinone oxidoreductase subunit C/D OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=nuoC PE=3 SV=1 105 486 3.0E-100
sp|P0A1Y6|NUOCD_SALTY NADH-quinone oxidoreductase subunit C/D OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=nuoC PE=3 SV=2 105 486 4.0E-100
sp|P0A1Y7|NUOCD_SALTI NADH-quinone oxidoreductase subunit C/D OS=Salmonella typhi GN=nuoC PE=3 SV=2 105 486 4.0E-100
sp|B4TBJ2|NUOCD_SALHS NADH-quinone oxidoreductase subunit C/D OS=Salmonella heidelberg (strain SL476) GN=nuoC PE=3 SV=2 105 486 4.0E-100
sp|B5RCF1|NUOCD_SALG2 NADH-quinone oxidoreductase subunit C/D OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=nuoC PE=3 SV=2 105 486 4.0E-100
sp|B5R307|NUOCD_SALEP NADH-quinone oxidoreductase subunit C/D OS=Salmonella enteritidis PT4 (strain P125109) GN=nuoC PE=3 SV=2 105 486 4.0E-100
sp|B5FPG7|NUOCD_SALDC NADH-quinone oxidoreductase subunit C/D OS=Salmonella dublin (strain CT_02021853) GN=nuoC PE=3 SV=2 105 486 4.0E-100
sp|Q2JWB1|NDHH_SYNJA NAD(P)H-quinone oxidoreductase subunit H OS=Synechococcus sp. (strain JA-3-3Ab) GN=ndhH PE=3 SV=1 105 486 4.0E-100
sp|B4TPK8|NUOCD_SALSV NADH-quinone oxidoreductase subunit C/D OS=Salmonella schwarzengrund (strain CVM19633) GN=nuoC PE=3 SV=1 105 486 4.0E-100
sp|B5BCM0|NUOCD_SALPK NADH-quinone oxidoreductase subunit C/D OS=Salmonella paratyphi A (strain AKU_12601) GN=nuoC PE=3 SV=1 105 486 4.0E-100
sp|A9N582|NUOCD_SALPB NADH-quinone oxidoreductase subunit C/D OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=nuoC PE=3 SV=1 105 486 4.0E-100
sp|Q5PN53|NUOCD_SALPA NADH-quinone oxidoreductase subunit C/D OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=nuoC PE=3 SV=1 105 486 4.0E-100
sp|B5EZK7|NUOCD_SALA4 NADH-quinone oxidoreductase subunit C/D OS=Salmonella agona (strain SL483) GN=nuoC PE=3 SV=1 105 486 4.0E-100
sp|B4SYZ7|NUOCD_SALNS NADH-quinone oxidoreductase subunit C/D OS=Salmonella newport (strain SL254) GN=nuoC PE=3 SV=1 105 486 5.0E-100
sp|A9MJ99|NUOCD_SALAR NADH-quinone oxidoreductase subunit C/D OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=nuoC PE=3 SV=1 105 486 5.0E-100
sp|Q3KA61|NUOCD_PSEPF NADH-quinone oxidoreductase subunit C/D OS=Pseudomonas fluorescens (strain Pf0-1) GN=nuoC PE=3 SV=1 105 486 5.0E-100
sp|Q67P19|NUOD1_SYMTH NADH-quinone oxidoreductase subunit D 1 OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=nuoD1 PE=3 SV=1 95 486 5.0E-100
sp|Q0I6T6|NDHH_SYNS3 NAD(P)H-quinone oxidoreductase subunit H OS=Synechococcus sp. (strain CC9311) GN=ndhH PE=3 SV=1 104 486 5.0E-100
sp|A4WT70|NUOCD_RHOS5 NADH-quinone oxidoreductase subunit C/D OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=nuoC PE=3 SV=1 105 486 5.0E-100
sp|Q2NSK1|NUOCD_SODGM NADH-quinone oxidoreductase subunit C/D OS=Sodalis glossinidius (strain morsitans) GN=nuoC PE=3 SV=1 105 486 5.0E-100
sp|B1X8Z8|NUOCD_ECODH NADH-quinone oxidoreductase subunit C/D OS=Escherichia coli (strain K12 / DH10B) GN=nuoC PE=3 SV=1 105 486 5.0E-100
sp|Q6D2R9|NUOCD_PECAS NADH-quinone oxidoreductase subunit C/D OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=nuoC PE=3 SV=1 105 486 6.0E-100
sp|Q2JN25|NDHH_SYNJB NAD(P)H-quinone oxidoreductase subunit H OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=ndhH PE=3 SV=1 105 486 7.0E-100
sp|P33599|NUOCD_ECOLI NADH-quinone oxidoreductase subunit C/D OS=Escherichia coli (strain K12) GN=nuoC PE=1 SV=3 105 486 8.0E-100
sp|C1DL16|NUOCD_AZOVD NADH-quinone oxidoreductase subunit C/D OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=nuoC PE=3 SV=1 105 486 8.0E-100
sp|A6TBX2|NUOCD_KLEP7 NADH-quinone oxidoreductase subunit C/D OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=nuoC PE=3 SV=1 105 486 9.0E-100
sp|B2V8J2|NUOCD_SULSY NADH-quinone oxidoreductase subunit C/D OS=Sulfurihydrogenibium sp. (strain YO3AOP1) GN=nuoC PE=3 SV=1 99 486 1.0E-99
sp|Q3YZS4|NUOCD_SHISS NADH-quinone oxidoreductase subunit C/D OS=Shigella sonnei (strain Ss046) GN=nuoC PE=3 SV=1 105 486 1.0E-99
sp|Q83QS6|NUOCD_SHIFL NADH-quinone oxidoreductase subunit C/D OS=Shigella flexneri GN=nuoC PE=3 SV=1 105 486 1.0E-99
sp|Q32DQ3|NUOCD_SHIDS NADH-quinone oxidoreductase subunit C/D OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=nuoC PE=3 SV=1 105 486 1.0E-99
sp|Q31YH5|NUOCD_SHIBS NADH-quinone oxidoreductase subunit C/D OS=Shigella boydii serotype 4 (strain Sb227) GN=nuoC PE=3 SV=1 105 486 1.0E-99
sp|B7LM46|NUOCD_ESCF3 NADH-quinone oxidoreductase subunit C/D OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=nuoC PE=3 SV=1 105 486 1.0E-99
sp|B1LLN9|NUOCD_ECOSM NADH-quinone oxidoreductase subunit C/D OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=nuoC PE=3 SV=1 105 486 1.0E-99
sp|B6I7N6|NUOCD_ECOSE NADH-quinone oxidoreductase subunit C/D OS=Escherichia coli (strain SE11) GN=nuoC PE=3 SV=1 105 486 1.0E-99
sp|B7N5P8|NUOCD_ECOLU NADH-quinone oxidoreductase subunit C/D OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=nuoC PE=3 SV=1 105 486 1.0E-99
sp|B1IXQ6|NUOCD_ECOLC NADH-quinone oxidoreductase subunit C/D OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=nuoC PE=3 SV=1 105 486 1.0E-99
sp|A8A2F5|NUOCD_ECOHS NADH-quinone oxidoreductase subunit C/D OS=Escherichia coli O9:H4 (strain HS) GN=nuoC PE=3 SV=1 105 486 1.0E-99
sp|B7M5W5|NUOCD_ECO8A NADH-quinone oxidoreductase subunit C/D OS=Escherichia coli O8 (strain IAI1) GN=nuoC PE=3 SV=1 105 486 1.0E-99
sp|B7NNW5|NUOCD_ECO7I NADH-quinone oxidoreductase subunit C/D OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=nuoC PE=3 SV=1 105 486 1.0E-99
sp|B7LAU8|NUOCD_ECO55 NADH-quinone oxidoreductase subunit C/D OS=Escherichia coli (strain 55989 / EAEC) GN=nuoC PE=3 SV=1 105 486 1.0E-99
sp|A7ZPA0|NUOCD_ECO24 NADH-quinone oxidoreductase subunit C/D OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=nuoC PE=3 SV=1 105 486 1.0E-99
sp|B5XNV6|NUOCD_KLEP3 NADH-quinone oxidoreductase subunit C/D OS=Klebsiella pneumoniae (strain 342) GN=nuoC PE=3 SV=1 105 486 1.0E-99
sp|Q2RJU4|NUOD_MOOTA NADH-quinone oxidoreductase subunit D OS=Moorella thermoacetica (strain ATCC 39073) GN=nuoD PE=3 SV=1 94 486 1.0E-99
sp|B7UFU4|NUOCD_ECO27 NADH-quinone oxidoreductase subunit C/D OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=nuoC PE=3 SV=1 105 486 2.0E-99
sp|Q04V69|NUOD_LEPBJ NADH-quinone oxidoreductase subunit D OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=nuoD PE=3 SV=1 102 485 2.0E-99
sp|Q0T2K1|NUOCD_SHIF8 NADH-quinone oxidoreductase subunit C/D OS=Shigella flexneri serotype 5b (strain 8401) GN=nuoC PE=3 SV=1 105 486 2.0E-99
sp|Q0TFG0|NUOCD_ECOL5 NADH-quinone oxidoreductase subunit C/D OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=nuoC PE=3 SV=1 105 486 2.0E-99
sp|Q1R9D1|NUOCD_ECOUT NADH-quinone oxidoreductase subunit C/D OS=Escherichia coli (strain UTI89 / UPEC) GN=nuoC PE=3 SV=1 105 486 2.0E-99
sp|Q8FFJ7|NUOCD_ECOL6 NADH-quinone oxidoreductase subunit C/D OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=nuoC PE=3 SV=1 105 486 2.0E-99
sp|A1ADD4|NUOCD_ECOK1 NADH-quinone oxidoreductase subunit C/D OS=Escherichia coli O1:K1 / APEC GN=nuoC PE=3 SV=1 105 486 2.0E-99
sp|B7MXG5|NUOCD_ECO81 NADH-quinone oxidoreductase subunit C/D OS=Escherichia coli O81 (strain ED1a) GN=nuoC PE=3 SV=1 105 486 2.0E-99
sp|B7MG50|NUOCD_ECO45 NADH-quinone oxidoreductase subunit C/D OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=nuoC PE=3 SV=1 105 486 2.0E-99
sp|B2TW67|NUOCD_SHIB3 NADH-quinone oxidoreductase subunit C/D OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=nuoC PE=3 SV=1 105 486 2.0E-99
sp|A5GP75|NDHH_SYNPW NAD(P)H-quinone oxidoreductase subunit H OS=Synechococcus sp. (strain WH7803) GN=ndhH PE=3 SV=1 104 486 3.0E-99
sp|A0LJM5|NUBCD_SYNFM NADH-quinone oxidoreductase subunit B/C/D OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=nuoBCD PE=3 SV=1 104 486 3.0E-99
sp|Q04YA7|NUOD_LEPBL NADH-quinone oxidoreductase subunit D OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=nuoD PE=3 SV=1 102 485 3.0E-99
sp|B5YXS6|NUOCD_ECO5E NADH-quinone oxidoreductase subunit C/D OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=nuoC PE=3 SV=1 105 486 3.0E-99
sp|Q8XCW9|NUOCD_ECO57 NADH-quinone oxidoreductase subunit C/D OS=Escherichia coli O157:H7 GN=nuoC PE=3 SV=1 105 486 3.0E-99
sp|Q630V1|NUOD_BACCZ NADH-quinone oxidoreductase subunit D OS=Bacillus cereus (strain ZK / E33L) GN=nuoD PE=3 SV=1 105 485 3.0E-99
sp|P57254|NUOCD_BUCAI NADH-quinone oxidoreductase subunit C/D OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=nuoC PE=3 SV=1 96 486 5.0E-99
sp|B8D761|NUOCD_BUCAT NADH-quinone oxidoreductase subunit C/D OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7) GN=nuoC PE=3 SV=1 96 486 5.0E-99
sp|Q57M30|NUOCD_SALCH NADH-quinone oxidoreductase subunit C/D OS=Salmonella choleraesuis (strain SC-B67) GN=nuoC PE=3 SV=2 105 486 5.0E-99
sp|B2VIV5|NUOCD_ERWT9 NADH-quinone oxidoreductase subunit C/D OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=nuoC PE=3 SV=1 105 486 5.0E-99
sp|C0Q041|NUOCD_SALPC NADH-quinone oxidoreductase subunit C/D OS=Salmonella paratyphi C (strain RKS4594) GN=nuoC PE=3 SV=1 105 486 6.0E-99
sp|B8D8V7|NUOCD_BUCA5 NADH-quinone oxidoreductase subunit C/D OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A) GN=nuoC PE=3 SV=1 96 486 6.0E-99
sp|Q87ZQ7|NUOCD_PSESM NADH-quinone oxidoreductase subunit C/D OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=nuoC PE=3 SV=1 67 486 6.0E-99
sp|Q1I7Z8|NUOCD_PSEE4 NADH-quinone oxidoreductase subunit C/D OS=Pseudomonas entomophila (strain L48) GN=nuoC PE=3 SV=1 105 486 7.0E-99
sp|Q7VE17|NDHH_PROMA NAD(P)H-quinone oxidoreductase subunit H OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=ndhH PE=3 SV=1 104 486 7.0E-99
sp|B1J6N2|NUOCD_PSEPW NADH-quinone oxidoreductase subunit C/D OS=Pseudomonas putida (strain W619) GN=nuoC PE=3 SV=1 105 486 7.0E-99
sp|B4SBZ0|NUOD_PELPB NADH-quinone oxidoreductase subunit D OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=nuoD PE=3 SV=1 107 486 8.0E-99
sp|Q88FH5|NUOCD_PSEPK NADH-quinone oxidoreductase subunit C/D OS=Pseudomonas putida (strain KT2440) GN=nuoC PE=3 SV=1 105 486 8.0E-99
sp|Q492H8|NUOCD_BLOPB NADH-quinone oxidoreductase subunit C/D OS=Blochmannia pennsylvanicus (strain BPEN) GN=nuoC PE=3 SV=1 97 486 8.0E-99
sp|Q8EI31|NUOCD_SHEON NADH-quinone oxidoreductase subunit C/D OS=Shewanella oneidensis (strain MR-1) GN=nuoC PE=3 SV=1 105 486 8.0E-99
sp|A5W190|NUOCD_PSEP1 NADH-quinone oxidoreductase subunit C/D OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=nuoC PE=3 SV=1 105 486 9.0E-99
sp|B0KMY0|NUOCD_PSEPG NADH-quinone oxidoreductase subunit C/D OS=Pseudomonas putida (strain GB-1) GN=nuoC PE=3 SV=1 105 486 1.0E-98
sp|Q3AVZ9|NDHH_SYNS9 NAD(P)H-quinone oxidoreductase subunit H OS=Synechococcus sp. (strain CC9902) GN=ndhH PE=3 SV=1 104 486 1.0E-98
sp|Q7TUL1|NDHH_PROMM NAD(P)H-quinone oxidoreductase subunit H OS=Prochlorococcus marinus (strain MIT 9313) GN=ndhH PE=3 SV=1 104 486 1.0E-98
sp|Q3AGW8|NDHH_SYNSC NAD(P)H-quinone oxidoreductase subunit H OS=Synechococcus sp. (strain CC9605) GN=ndhH PE=3 SV=1 104 486 2.0E-98
sp|Q48H52|NUOCD_PSE14 NADH-quinone oxidoreductase subunit C/D OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=nuoC PE=3 SV=1 105 486 2.0E-98
sp|Q4ZRJ1|NUOCD_PSEU2 NADH-quinone oxidoreductase subunit C/D OS=Pseudomonas syringae pv. syringae (strain B728a) GN=nuoC PE=3 SV=1 105 486 2.0E-98
sp|Q6A6G1|NUOD_PROAC NADH-quinone oxidoreductase subunit D OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=nuoD PE=3 SV=1 105 486 2.0E-98
sp|P12131|NDHH_MARPO NAD(P)H-quinone oxidoreductase subunit H, chloroplastic OS=Marchantia polymorpha GN=ndhH PE=3 SV=1 99 486 2.0E-98
sp|A4SLP2|NUOCD_AERS4 NADH-quinone oxidoreductase subunit C/D OS=Aeromonas salmonicida (strain A449) GN=nuoC PE=3 SV=1 105 486 2.0E-98
sp|Q3B4W0|NUOD_CHLL7 NADH-quinone oxidoreductase subunit D OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=nuoD PE=3 SV=1 90 486 4.0E-98
sp|A2T389|NDHH_ANGEV NAD(P)H-quinone oxidoreductase subunit H, chloroplastic OS=Angiopteris evecta GN=ndhH PE=3 SV=1 105 486 4.0E-98
sp|Q7U3X8|NDHH_SYNPX NAD(P)H-quinone oxidoreductase subunit H OS=Synechococcus sp. (strain WH8102) GN=ndhH PE=3 SV=1 104 486 5.0E-98
sp|Q46HK0|NDHH_PROMT NAD(P)H-quinone oxidoreductase subunit H OS=Prochlorococcus marinus (strain NATL2A) GN=ndhH PE=3 SV=1 104 486 5.0E-98
sp|A2C001|NDHH_PROM1 NAD(P)H-quinone oxidoreductase subunit H OS=Prochlorococcus marinus (strain NATL1A) GN=ndhH PE=3 SV=1 104 486 6.0E-98
sp|A2CD94|NDHH_PROM3 NAD(P)H-quinone oxidoreductase subunit H OS=Prochlorococcus marinus (strain MIT 9303) GN=ndhH PE=3 SV=1 104 486 1.0E-97
sp|B3EI96|NUOD_CHLL2 NADH-quinone oxidoreductase subunit D OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=nuoD PE=3 SV=1 105 486 2.0E-97
sp|Q9MUL0|NDHH_MESVI NAD(P)H-quinone oxidoreductase subunit H, chloroplastic OS=Mesostigma viride GN=ndhH PE=3 SV=1 104 486 2.0E-97
sp|B3QY45|NUOD2_CHLT3 NADH-quinone oxidoreductase subunit D 2 OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) GN=nuoD2 PE=3 SV=1 81 486 2.0E-97
sp|A9L9F3|NDHH_LEMMI NAD(P)H-quinone oxidoreductase subunit H, chloroplastic OS=Lemna minor GN=ndhH PE=3 SV=1 105 486 3.0E-97
sp|Q19V59|NDHH_CHLAT NAD(P)H-quinone oxidoreductase subunit H, chloroplastic OS=Chlorokybus atmophyticus GN=ndhH PE=3 SV=2 104 486 3.0E-97
sp|Q6YXP7|NDHH_PHYPA NAD(P)H-quinone oxidoreductase subunit H, chloroplastic OS=Physcomitrella patens subsp. patens GN=ndhH PE=3 SV=1 99 486 5.0E-97
sp|P25709|NDHH_MAIZE NAD(P)H-quinone oxidoreductase subunit H, chloroplastic OS=Zea mays GN=ndhH PE=3 SV=1 105 486 5.0E-97
sp|A4SF45|NUOD_CHLPM NADH-quinone oxidoreductase subunit D OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=nuoD PE=3 SV=1 102 486 7.0E-97
sp|Q1ACE3|NDHH_CHAVU NAD(P)H-quinone oxidoreductase subunit H, chloroplastic OS=Chara vulgaris GN=ndhH PE=3 SV=1 98 486 8.0E-97
sp|A1EA65|NDHH_AGRST NAD(P)H-quinone oxidoreductase subunit H, chloroplastic OS=Agrostis stolonifera GN=ndhH-A PE=3 SV=1 105 486 9.0E-97
sp|B2J184|NDHH_NOSP7 NAD(P)H-quinone oxidoreductase subunit H OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=ndhH PE=3 SV=1 104 486 2.0E-96
sp|Q85UU0|NDHH_ANTFO NAD(P)H-quinone oxidoreductase subunit H, chloroplastic OS=Anthoceros formosae GN=ndhH PE=2 SV=1 104 486 2.0E-96
sp|Q32S01|NDHH_STAPU NAD(P)H-quinone oxidoreductase subunit H, chloroplastic OS=Staurastrum punctulatum GN=ndhH PE=3 SV=1 105 486 2.0E-96
sp|A8ERL4|NUOCD_ARCB4 NADH-quinone oxidoreductase subunit C/D OS=Arcobacter butzleri (strain RM4018) GN=nuoC PE=3 SV=1 105 486 4.0E-96
sp|Q8K9Y5|NUOCD_BUCAP NADH-quinone oxidoreductase subunit C/D OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=nuoC PE=3 SV=1 105 486 4.0E-96
sp|Q6ENP1|NDHH_SACOF NAD(P)H-quinone oxidoreductase subunit H, chloroplastic OS=Saccharum officinarum GN=ndhH PE=3 SV=1 105 486 5.0E-96
sp|Q6L3D4|NDHH_SACHY NAD(P)H-quinone oxidoreductase subunit H, chloroplastic OS=Saccharum hybrid GN=ndhH PE=3 SV=1 105 486 5.0E-96
sp|Q3ASW5|NUOD_CHLCH NADH-quinone oxidoreductase subunit D OS=Chlorobium chlorochromatii (strain CaD3) GN=nuoD PE=3 SV=1 80 486 5.0E-96
sp|P27724|NDHH_SYNY3 NAD(P)H-quinone oxidoreductase subunit H OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=ndhH PE=1 SV=3 104 486 6.0E-96
sp|B8Y2U9|NDHH_FESAR NAD(P)H-quinone oxidoreductase subunit H, chloroplastic OS=Festuca arundinacea GN=ndhH PE=3 SV=1 105 486 7.0E-96
sp|A1E9Y0|NDHH_SORBI NAD(P)H-quinone oxidoreductase subunit H, chloroplastic OS=Sorghum bicolor GN=ndhH PE=3 SV=1 105 486 7.0E-96
sp|A8G2H8|NDHH_PROM2 NAD(P)H-quinone oxidoreductase subunit H OS=Prochlorococcus marinus (strain MIT 9215) GN=ndhH PE=3 SV=1 104 486 7.0E-96
sp|A3PAP0|NDHH_PROM0 NAD(P)H-quinone oxidoreductase subunit H OS=Prochlorococcus marinus (strain MIT 9301) GN=ndhH PE=3 SV=1 104 486 7.0E-96
sp|Q31D09|NDHH_PROM9 NAD(P)H-quinone oxidoreductase subunit H OS=Prochlorococcus marinus (strain MIT 9312) GN=ndhH PE=3 SV=1 104 486 8.0E-96
sp|A2BUE9|NDHH_PROM5 NAD(P)H-quinone oxidoreductase subunit H OS=Prochlorococcus marinus (strain MIT 9515) GN=ndhH PE=3 SV=1 104 486 8.0E-96
sp|Q95H42|NDHH_WHEAT NAD(P)H-quinone oxidoreductase subunit H, chloroplastic OS=Triticum aestivum GN=ndhH PE=3 SV=1 105 486 8.0E-96
sp|A2BNW7|NDHH_PROMS NAD(P)H-quinone oxidoreductase subunit H OS=Prochlorococcus marinus (strain AS9601) GN=ndhH PE=3 SV=1 104 486 8.0E-96
sp|Q7V3B0|NDHH_PROMP NAD(P)H-quinone oxidoreductase subunit H OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=ndhH PE=3 SV=1 104 486 8.0E-96
sp|Q1QST4|NUOCD_CHRSD NADH-quinone oxidoreductase subunit C/D OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=nuoC PE=3 SV=1 88 486 9.0E-96
sp|O98691|NDHH_HORVU NAD(P)H-quinone oxidoreductase subunit H, chloroplastic OS=Hordeum vulgare GN=ndhH PE=3 SV=1 105 486 9.0E-96
sp|P0C337|NDHH_ORYSJ NAD(P)H-quinone oxidoreductase subunit H, chloroplastic OS=Oryza sativa subsp. japonica GN=ndhH PE=3 SV=1 105 486 1.0E-95
sp|P0C336|NDHH_ORYSI NAD(P)H-quinone oxidoreductase subunit H, chloroplastic OS=Oryza sativa subsp. indica GN=ndhH PE=3 SV=1 105 486 1.0E-95
[Show less]

GO

GO Term Description Terminal node
GO:0048038 quinone binding Yes
GO:0051287 NAD binding Yes
GO:0016651 oxidoreductase activity, acting on NAD(P)H Yes
GO:0003674 molecular_function No
GO:0016491 oxidoreductase activity No
GO:1901363 heterocyclic compound binding No
GO:0003824 catalytic activity No
GO:0036094 small molecule binding No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No
GO:0000166 nucleotide binding No
GO:1901265 nucleoside phosphate binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4044
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3871 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|2944
Ophiocordyceps camponoti-floridani Ophcf2|04431
Ophiocordyceps camponoti-rufipedis Ophun1|4846
Ophiocordyceps kimflemingae Ophio5|5090
Ophiocordyceps subramaniannii Hirsu2|8143

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|3871
MAPIHRLAGQAAKHLCLRPKTTTVAAPLAAAAAAAAAAPPCLATRPLSTSKLHRYADVDSTPTRIVPADGTPDDI
YGAARQLPAATKKTQSENSVEHRKVRHYTVNFGPQHPAAHGVLRLILELSGEEIVRADPHVGLLHRGTEKLIEYK
TYLQALPYFDRLDYVSMMTNEQCFSLAVEKLLNIEIPERAKYIRTLFGEITRVLNHLMSVLSHAMDVGALTPFLW
GFEEREKLMEFYERVSGARLHAAYVRPGGVHQDIPVGLLDDIYQWATQFGDRIDETEEMLTDNRIWIERLRGVGV
VSAAEALNLSFTGVMLRGSGVPWDIRKSQPYDAYDKVEFDVPVGKFGDCYDRYLCRMEEFRQSLRIIHQCLNQMP
AGPVRVEDYKVSPPPRAAMKENMEALIHHFLLYTKGYAVPPGETYSVIEAPKGEMGVYLVSDGSERPYRCHIRAP
GFAHLSGFDHISRGHLLADAVAVIGTMDLVFGEVDR*
Coding >OphauG2|3871
ATGGCTCCTATACACAGGCTTGCTGGTCAGGCGGCCAAGCATCTGTGTCTGCGGCCAAAGACGACTACGGTAGCA
GCGCCACTAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCTCCTCCATGTCTCGCCACCCGGCCCTTGTCAACATCC
AAGCTACACAGATATGCCGACGTGGACTCTACACCCACCCGAATTGTGCCCGCGGACGGCACCCCAGACGACATA
TATGGTGCGGCGCGCCAATTACCGGCCGCGACCAAAAAGACACAGAGTGAGAATTCGGTCGAGCATCGCAAAGTG
CGTCACTACACAGTCAACTTTGGCCCCCAGCATCCCGCTGCCCACGGCGTGCTGCGCCTCATCCTTGAACTTAGC
GGCGAAGAGATTGTTCGCGCCGATCCTCACGTTGGTCTGCTGCACCGCGGCACGGAAAAGCTCATCGAGTACAAG
ACTTATCTTCAGGCCCTGCCCTACTTTGACCGGCTCGACTATGTCTCCATGATGACAAATGAGCAGTGTTTTTCC
CTTGCTGTTGAGAAGCTGCTCAACATCGAGATTCCTGAGCGCGCAAAGTACATTCGCACTTTGTTTGGCGAAATA
ACTCGTGTTCTCAACCACCTAATGTCCGTCTTGTCTCACGCCATGGATGTCGGTGCCCTCACCCCTTTTCTATGG
GGCTTCGAGGAACGAGAAAAGCTCATGGAGTTTTATGAGCGTGTTTCGGGTGCTCGTCTCCACGCTGCATATGTA
CGCCCTGGTGGCGTTCACCAAGACATTCCTGTAGGCCTTCTCGACGACATCTATCAGTGGGCCACGCAATTTGGC
GACCGAATCGACGAGACGGAAGAGATGCTCACAGACAACCGTATTTGGATTGAACGGCTAAGGGGCGTTGGTGTT
GTCTCTGCGGCCGAAGCTCTGAATCTCTCCTTCACGGGCGTCATGCTCCGCGGCTCTGGTGTGCCATGGGATATT
CGTAAGAGCCAGCCCTATGATGCCTACGACAAGGTCGAATTCGATGTGCCTGTGGGCAAGTTTGGCGATTGCTAT
GACCGCTATTTGTGTCGCATGGAAGAGTTCCGCCAGTCGCTGCGCATTATTCACCAGTGTCTCAACCAGATGCCT
GCCGGTCCAGTTCGCGTCGAGGACTACAAGGTCTCTCCACCCCCCCGTGCCGCCATGAAGGAGAACATGGAGGCT
CTTATTCACCACTTCCTGCTTTATACAAAGGGCTACGCCGTGCCTCCCGGAGAAACATACTCTGTCATTGAGGCC
CCCAAGGGAGAAATGGGTGTTTATCTTGTGAGCGACGGTAGCGAGCGCCCATATAGATGCCATATCCGGGCCCCT
GGATTTGCACATCTCAGCGGCTTCGACCACATTTCTCGCGGCCACCTGTTAGCTGACGCTGTTGCTGTCATTGGC
ACCATGGATCTGGTCTTTGGCGAAGTCGATCGGTAG
Transcript >OphauG2|3871
ATGGCTCCTATACACAGGCTTGCTGGTCAGGCGGCCAAGCATCTGTGTCTGCGGCCAAAGACGACTACGGTAGCA
GCGCCACTAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCTCCTCCATGTCTCGCCACCCGGCCCTTGTCAACATCC
AAGCTACACAGATATGCCGACGTGGACTCTACACCCACCCGAATTGTGCCCGCGGACGGCACCCCAGACGACATA
TATGGTGCGGCGCGCCAATTACCGGCCGCGACCAAAAAGACACAGAGTGAGAATTCGGTCGAGCATCGCAAAGTG
CGTCACTACACAGTCAACTTTGGCCCCCAGCATCCCGCTGCCCACGGCGTGCTGCGCCTCATCCTTGAACTTAGC
GGCGAAGAGATTGTTCGCGCCGATCCTCACGTTGGTCTGCTGCACCGCGGCACGGAAAAGCTCATCGAGTACAAG
ACTTATCTTCAGGCCCTGCCCTACTTTGACCGGCTCGACTATGTCTCCATGATGACAAATGAGCAGTGTTTTTCC
CTTGCTGTTGAGAAGCTGCTCAACATCGAGATTCCTGAGCGCGCAAAGTACATTCGCACTTTGTTTGGCGAAATA
ACTCGTGTTCTCAACCACCTAATGTCCGTCTTGTCTCACGCCATGGATGTCGGTGCCCTCACCCCTTTTCTATGG
GGCTTCGAGGAACGAGAAAAGCTCATGGAGTTTTATGAGCGTGTTTCGGGTGCTCGTCTCCACGCTGCATATGTA
CGCCCTGGTGGCGTTCACCAAGACATTCCTGTAGGCCTTCTCGACGACATCTATCAGTGGGCCACGCAATTTGGC
GACCGAATCGACGAGACGGAAGAGATGCTCACAGACAACCGTATTTGGATTGAACGGCTAAGGGGCGTTGGTGTT
GTCTCTGCGGCCGAAGCTCTGAATCTCTCCTTCACGGGCGTCATGCTCCGCGGCTCTGGTGTGCCATGGGATATT
CGTAAGAGCCAGCCCTATGATGCCTACGACAAGGTCGAATTCGATGTGCCTGTGGGCAAGTTTGGCGATTGCTAT
GACCGCTATTTGTGTCGCATGGAAGAGTTCCGCCAGTCGCTGCGCATTATTCACCAGTGTCTCAACCAGATGCCT
GCCGGTCCAGTTCGCGTCGAGGACTACAAGGTCTCTCCACCCCCCCGTGCCGCCATGAAGGAGAACATGGAGGCT
CTTATTCACCACTTCCTGCTTTATACAAAGGGCTACGCCGTGCCTCCCGGAGAAACATACTCTGTCATTGAGGCC
CCCAAGGGAGAAATGGGTGTTTATCTTGTGAGCGACGGTAGCGAGCGCCCATATAGATGCCATATCCGGGCCCCT
GGATTTGCACATCTCAGCGGCTTCGACCACATTTCTCGCGGCCACCTGTTAGCTGACGCTGTTGCTGTCATTGGC
ACCATGGATCTGGTCTTTGGCGAAGTCGATCGGTAG
Gene >OphauG2|3871
ATGGCTCCTATACACAGGCTTGCTGGTCAGGCGGCCAAGCATCTGTGTCTGCGGCCAAAGACGACTACGGTAGCA
GCGCCACTAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCTCCTCCATGTCTCGCCACCCGGCCCTTGTCAACATCC
AAGCTACACAGATATGCCGACGTGGACTCTACACCCACCCGAATTGTGCCCGCGGACGGCACCCCAGACGACATA
TATGGTGCGGCGCGCCAATTACCGGCCGCGACCAAAAAGACACAGAGTGAGAATTCGGTCGAGCATCGCAAAGTG
CGTCACTACACAGTCAACTTTGGCCCCCAGCATCCCGCTGCCCACGGCGTGCTGCGCCTCATCCTTGAACTTAGC
GGCGAAGAGATTGTTCGCGCCGATCCTCACGTTGGTCTGCTGCACCGCGGCACGGAAAAGCTCATCGAGTACAAG
ACTTATCTTCAGGCCCTGCCCTACTTTGACCGGCTCGACTATGTCTCCATGATGACAAATGAGCAGTGTTTTTCC
CTTGCTGTTGAGAAGCTGCTCAACATCGAGATTCCTGAGCGCGCAAAGTACATTCGCACTTTGTTTGGCGAAATA
ACTCGTGTTCTCAACCACCTAATGTCCGTCTTGTCTCACGCCATGGATGTCGGTGCCCTCACCCCTTTTCTATGG
GGCTTCGAGGAACGAGAAAAGCTCATGGTTAGTCTCACTCTTTTGTGCCCATTTTCTGGACACTGACCGCCATGG
CTAACTCTCTGTGTCTAGGAGTTTTATGAGCGTGTTTCGGGTGCTCGTCTCCACGCTGCATATGTACGCCCTGGT
GGCGTTCACCAAGACATTCCTGTAGGCCTTCTCGACGACATCTATCAGTGGGCCACGCAATTTGGCGACCGAATC
GACGAGACGGAAGAGATGCTCACAGACAACCGTATTTGGATTGAACGGCTAAGGGGCGTTGGTGTTGTCTCTGCG
GCCGAAGCTCTGAATCTCTCCTTCACGGGCGTCATGCTCCGCGGCTCTGGTGTGCCATGGGATATTCGTAAGAGC
CAGCCCTATGATGCCTACGACAAGGTCGAATTCGATGTGCCTGTGGGCAAGTTTGGCGATTGCTATGACCGCTAT
TTGTGTCGCATGGAAGAGTTCCGCCAGTCGCTGCGCATTATTCACCAGTGTCTCAACCAGATGCCTGCCGGTCCA
GTTCGCGTCGAGGACTACAAGGTCTCTCCACCCCCCCGTGCCGCCATGAAGGAGAACATGGAGGCTCTTATTCAC
CACTTCCTGCTTTATACAAAGGGCTACGCCGTGCCTCCCGGAGAAACATACTCTGTCATTGAGGCCCCCAAGGGA
GAAATGGGTGTTTATCTTGTGAGCGACGGTAGCGAGCGCCCATATAGATGCCATATCCGGGCCCCTGGATTTGCA
CATCTCAGCGGCTTCGACCACATTTCTCGCGGCCACCTGTTAGCTGACGCTGTTGCTGTCATTGGCACCATGGAT
CTGGTCTTTGGTACGAGGCCCCATCAAGACAATCAAGACGCATGAGAAGATATTTTTAGGCTGACAATTACTATA
GGCGAAGTCGATCGGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail