Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|3867
Gene name
LocationContig_302:8141..9863
Strand-
Gene length (bp)1722
Transcript length (bp)1602
Coding sequence length (bp)1602
Protein length (aa) 534

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03914 CBF CBF/Mak21 family 7.1E-36 307 464

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O94372|YG06_SCHPO Uncharacterized protein C1604.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1604.06c PE=3 SV=1 41 506 2.0E-95
sp|Q06512|NOC4_YEAST Nucleolar complex protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NOC4 PE=1 SV=1 49 521 1.0E-85
sp|Q4VBT2|NOC4L_DANRE Nucleolar complex protein 4 homolog OS=Danio rerio GN=noc4l PE=2 SV=1 45 506 9.0E-81
sp|Q5ZJC7|NOC4L_CHICK Nucleolar complex protein 4 homolog OS=Gallus gallus GN=NOC4L PE=2 SV=1 43 506 9.0E-79
sp|Q6NU91|NOC4B_XENLA Nucleolar complex protein 4 homolog B OS=Xenopus laevis GN=noc4l-b PE=2 SV=1 44 502 3.0E-75
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O94372|YG06_SCHPO Uncharacterized protein C1604.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1604.06c PE=3 SV=1 41 506 2.0E-95
sp|Q06512|NOC4_YEAST Nucleolar complex protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NOC4 PE=1 SV=1 49 521 1.0E-85
sp|Q4VBT2|NOC4L_DANRE Nucleolar complex protein 4 homolog OS=Danio rerio GN=noc4l PE=2 SV=1 45 506 9.0E-81
sp|Q5ZJC7|NOC4L_CHICK Nucleolar complex protein 4 homolog OS=Gallus gallus GN=NOC4L PE=2 SV=1 43 506 9.0E-79
sp|Q6NU91|NOC4B_XENLA Nucleolar complex protein 4 homolog B OS=Xenopus laevis GN=noc4l-b PE=2 SV=1 44 502 3.0E-75
sp|Q8BHY2|NOC4L_MOUSE Nucleolar complex protein 4 homolog OS=Mus musculus GN=Noc4l PE=2 SV=1 41 506 8.0E-75
sp|Q6NRQ2|NOC41_XENLA Nucleolar complex protein 4 homolog A OS=Xenopus laevis GN=noc4l-a PE=2 SV=1 1 514 1.0E-73
sp|Q5I0I8|NOC4L_RAT Nucleolar complex protein 4 homolog OS=Rattus norvegicus GN=Noc4l PE=2 SV=1 41 506 1.0E-71
sp|Q9BVI4|NOC4L_HUMAN Nucleolar complex protein 4 homolog OS=Homo sapiens GN=NOC4L PE=1 SV=1 43 506 1.0E-62
sp|P41843|YO93_CAEEL Uncharacterized protein T20B12.3 OS=Caenorhabditis elegans GN=T20B12.3 PE=3 SV=1 257 473 4.0E-32
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 44 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|3867
MAAQRSKRKCTLSDNKLSKKKRSLGSEADDKGDGGAQILLLEQGILESRKNYNDISVLLKTAHSRDSDESLLATV
ALCRVFIRLVAQGSLASKKGQKESENVVAAWLRERLQQYKELLLGLLADQELAATALTLCMRIVKAEAERSGERN
EYTFPFAFHQDVVGGIIRCDDDGVRQAYVEEYAEQFDDIRYYTFKSIKSLIQDKACTLFDRIFGLIARLDGVPQS
ADDLQDFYAARPPEQRHKLLSVKQHKKQGQEAWMAVMTLAKSKEECKGMLDIMATVIAPWFIEPELLADFLSNCY
HAGGSLSLLALSGVFFLIKERNLDYPSFYPKLYSLLDGDILHSKYRSRFFRLLDTFMASTHLPAALVASFIKRLS
RLALNAPPSAIAFAVPWIYNLIKRHPKCSLMIHRVTRGVEEKKQMEEQGFDDAFLAEETDPINTGAIDSSLWELV
QLQSHYHPNVATIAKIISEQFTKQAYNMEDFLDHSYGSLLDAETAKEVKKAPAIEFYFPKRVFLPDADGEDSLIT
KMWDFGQG*
Coding >OphauG2|3867
ATGGCCGCGCAACGGTCCAAACGCAAGTGCACTTTGTCGGACAATAAGCTTTCGAAAAAGAAGCGCTCTTTGGGA
AGCGAGGCCGACGATAAGGGAGACGGCGGCGCCCAGATACTATTATTGGAACAAGGCATCTTGGAATCGAGAAAA
AACTACAACGACATCAGCGTCTTGCTCAAGACAGCACACAGTCGAGACAGTGACGAATCATTGCTAGCCACGGTA
GCTCTCTGTCGCGTATTCATTCGGCTTGTCGCACAAGGCTCCTTGGCTTCGAAAAAGGGCCAAAAGGAGAGTGAA
AATGTTGTTGCTGCCTGGCTAAGAGAGAGGCTTCAACAGTACAAGGAGCTGCTGTTGGGCCTTTTGGCCGATCAG
GAGCTGGCAGCGACGGCATTAACACTGTGCATGAGAATTGTCAAGGCAGAGGCTGAGCGCTCGGGCGAGAGAAAC
GAATACACTTTTCCCTTTGCATTTCATCAAGACGTTGTTGGTGGCATTATACGGTGCGATGACGATGGTGTTCGA
CAGGCATACGTTGAGGAATACGCGGAGCAGTTTGACGACATTCGATATTATACCTTTAAATCTATCAAATCATTG
ATACAGGATAAGGCTTGTACGCTGTTTGACCGCATCTTTGGGCTCATTGCAAGACTAGATGGTGTGCCGCAGTCG
GCAGACGACCTACAAGACTTTTATGCGGCGCGCCCGCCGGAACAAAGGCATAAGCTCTTGTCGGTCAAGCAACAC
AAGAAGCAGGGCCAAGAGGCATGGATGGCGGTCATGACTCTGGCAAAGTCCAAGGAGGAGTGTAAAGGCATGCTC
GACATCATGGCGACTGTGATTGCACCGTGGTTTATCGAGCCCGAGCTACTGGCCGACTTTCTAAGCAATTGCTAC
CACGCAGGAGGCTCACTGTCTCTTCTGGCACTATCAGGGGTTTTTTTCCTGATTAAGGAGCGCAATTTGGATTAT
CCATCCTTTTACCCCAAACTCTACTCCCTACTGGATGGCGATATCCTTCACTCAAAGTACCGTTCGCGATTTTTC
CGGCTATTGGATACGTTTATGGCTTCGACTCATCTTCCGGCGGCTCTCGTTGCCAGCTTCATCAAGCGATTGTCA
CGGCTGGCGCTCAATGCGCCGCCGAGCGCCATTGCGTTTGCGGTGCCCTGGATTTACAACTTGATTAAGCGGCAT
CCAAAATGCTCCTTGATGATACATCGCGTCACGAGAGGGGTGGAAGAGAAGAAGCAGATGGAGGAGCAGGGATTT
GACGACGCGTTTCTGGCAGAAGAAACAGATCCAATAAATACAGGGGCTATTGACAGCAGTCTCTGGGAGCTGGTG
CAACTACAGTCGCACTATCACCCAAACGTGGCGACGATTGCCAAGATTATATCGGAGCAATTTACAAAACAAGCA
TACAACATGGAGGATTTTCTGGACCATAGTTATGGCAGTCTTTTGGATGCCGAGACGGCCAAGGAGGTCAAGAAG
GCTCCGGCGATTGAGTTTTATTTTCCCAAGAGAGTTTTTTTGCCAGACGCGGATGGGGAGGACAGCTTGATTACG
AAGATGTGGGATTTTGGACAAGGTTAG
Transcript >OphauG2|3867
ATGGCCGCGCAACGGTCCAAACGCAAGTGCACTTTGTCGGACAATAAGCTTTCGAAAAAGAAGCGCTCTTTGGGA
AGCGAGGCCGACGATAAGGGAGACGGCGGCGCCCAGATACTATTATTGGAACAAGGCATCTTGGAATCGAGAAAA
AACTACAACGACATCAGCGTCTTGCTCAAGACAGCACACAGTCGAGACAGTGACGAATCATTGCTAGCCACGGTA
GCTCTCTGTCGCGTATTCATTCGGCTTGTCGCACAAGGCTCCTTGGCTTCGAAAAAGGGCCAAAAGGAGAGTGAA
AATGTTGTTGCTGCCTGGCTAAGAGAGAGGCTTCAACAGTACAAGGAGCTGCTGTTGGGCCTTTTGGCCGATCAG
GAGCTGGCAGCGACGGCATTAACACTGTGCATGAGAATTGTCAAGGCAGAGGCTGAGCGCTCGGGCGAGAGAAAC
GAATACACTTTTCCCTTTGCATTTCATCAAGACGTTGTTGGTGGCATTATACGGTGCGATGACGATGGTGTTCGA
CAGGCATACGTTGAGGAATACGCGGAGCAGTTTGACGACATTCGATATTATACCTTTAAATCTATCAAATCATTG
ATACAGGATAAGGCTTGTACGCTGTTTGACCGCATCTTTGGGCTCATTGCAAGACTAGATGGTGTGCCGCAGTCG
GCAGACGACCTACAAGACTTTTATGCGGCGCGCCCGCCGGAACAAAGGCATAAGCTCTTGTCGGTCAAGCAACAC
AAGAAGCAGGGCCAAGAGGCATGGATGGCGGTCATGACTCTGGCAAAGTCCAAGGAGGAGTGTAAAGGCATGCTC
GACATCATGGCGACTGTGATTGCACCGTGGTTTATCGAGCCCGAGCTACTGGCCGACTTTCTAAGCAATTGCTAC
CACGCAGGAGGCTCACTGTCTCTTCTGGCACTATCAGGGGTTTTTTTCCTGATTAAGGAGCGCAATTTGGATTAT
CCATCCTTTTACCCCAAACTCTACTCCCTACTGGATGGCGATATCCTTCACTCAAAGTACCGTTCGCGATTTTTC
CGGCTATTGGATACGTTTATGGCTTCGACTCATCTTCCGGCGGCTCTCGTTGCCAGCTTCATCAAGCGATTGTCA
CGGCTGGCGCTCAATGCGCCGCCGAGCGCCATTGCGTTTGCGGTGCCCTGGATTTACAACTTGATTAAGCGGCAT
CCAAAATGCTCCTTGATGATACATCGCGTCACGAGAGGGGTGGAAGAGAAGAAGCAGATGGAGGAGCAGGGATTT
GACGACGCGTTTCTGGCAGAAGAAACAGATCCAATAAATACAGGGGCTATTGACAGCAGTCTCTGGGAGCTGGTG
CAACTACAGTCGCACTATCACCCAAACGTGGCGACGATTGCCAAGATTATATCGGAGCAATTTACAAAACAAGCA
TACAACATGGAGGATTTTCTGGACCATAGTTATGGCAGTCTTTTGGATGCCGAGACGGCCAAGGAGGTCAAGAAG
GCTCCGGCGATTGAGTTTTATTTTCCCAAGAGAGTTTTTTTGCCAGACGCGGATGGGGAGGACAGCTTGATTACG
AAGATGTGGGATTTTGGACAAGGTTAG
Gene >OphauG2|3867
ATGGCCGCGCAACGGTCCAAACGCAAGTGCACTTTGTCGGACAATAAGCTTTCGAAAAAGAAGCGCTCTTTGGGA
AGCGAGGCCGACGATAAGGGAGACGGCGGCGCCCAGATACTATTATTGGAACAAGGCATCTTGGAATCGAGAAAA
AACTACAACGACATCAGCGTCTTGCTCAAGACAGCACACAGTCGAGACAGTGACGAATCATTGCTAGCCACGGTA
GCTCTCTGTCGCGTATTCATTCGGCTTGTCGCACAAGGCTCCTTGGCTTCGAAAAAGGGCCAAAAGGAGAGTGAA
AATGTTGTTGCTGCCTGGCTAAGAGAGAGGCTTCAACAGTACAAGGAGCTGCTGTTGGGCCTTTTGGCCGATCAG
GAGCTGGCAGCGACGGCATTAACACTGTGCATGAGAATTGTCAAGGCAGAGGCTGAGCGCTCGGGCGAGAGAAAC
GAATACACTTTTCCCTTTGCATTTCATCAAGACGTTGTTGGTGGCATTATACGGTGCGATGACGATGGTGTTCGA
CAGGCATACGTTGAGGAATACGCGGAGCAGTTTGACGACATTCGATATTATACCTTTAAATCTATCAAGTATGTA
TGCTCGCGTCACGATTGTGCATCAAGCTTGACTCTATTAACAGGCAACGATTAGATCATTGATACAGGATAAGGC
TTGTACGCTGTTTGACCGCATCTTTGGGCTCATTGCAAGACTAGATGGTGTGCCGCAGTCGGCAGACGACCTACA
AGACTTTTATGCGGCGCGCCCGCCGGAACAAAGGCATAAGCTCTTGTCGGTCAAGCAACACAAGAAGCAGGGCCA
AGAGGCATGGATGGCGGTCATGACTCTGGCAAAGTCCAAGGAGGAGTGTAAAGGCATGCTCGACATCATGGCGAC
TGTGATTGCACCGTGGTTTATCGAGCCCGAGCTACTGGCCGACTTTCTAAGCAATTGCTACCACGCAGGAGGCTC
ACTGTCTCTTCTGGCACTATCAGGGGTTTTTTTCCTGATTAAGGAGCGCAATTTGGATTATCCATCCTTTTACCC
CAAACTCTACTCCCTACTGGATGGCGATATCCTTCACTCAAAGTACCGTTCGCGATTTTTCCGGCTATTGGATAC
GTTTATGGCTTCGACTCATCTTCCGGCGGCTCTCGTTGCCAGCTTCATCAAGCGATTGTCACGGCTGGCGCTCAA
TGCGCCGCCGAGCGCCATTGCGTTTGCGGTGCCCTGGATTTACAACTTGATTAAGCGGCATCCAAAATGCTCCTT
GATGATACATCGCGTCACGAGAGGGGTGGAAGAGAAGAAGCAGATGGAGGAGCAGGGATTTGACGACGCGTTTCT
GGCAGAAGAAACAGATCCAATAAATACAGGGGCTATTGACAGCAGTCTCTGGGAGCTGGTGCAACTACAGTCGCA
CTATCACCCAAACGTGGCGACGATTGCCAAGATTATATCGGAGCAATTTACAAAACAAGCATACAACATGGAGGA
TTTTCTGGACCATAGTTATGGCAGTGTAAGCAAGATGTAGTTGCTTCTGGCTTGGGAGGTGGCTGCTGACTTGAT
TGTGGATAGCTTTTGGATGCCGAGACGGCCAAGGAGGTCAAGAAGGCTCCGGCGATTGAGTTTTATTTTCCCAAG
AGAGTTTTTTTGCCAGACGCGGATGGGGAGGACAGCTTGATTACGAAGATGTGGGATTTTGGACAAGGTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail