Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|386
Gene name
LocationContig_109:10383..12592
Strand-
Gene length (bp)2209
Transcript length (bp)2055
Coding sequence length (bp)2055
Protein length (aa) 685

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00400 WD40 WD domain, G-beta repeat 2.0E-04 433 465

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q09786|YA98_SCHPO Uncharacterized WD repeat-containing protein C13G6.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC13G6.08 PE=3 SV=1 211 676 2.0E-49
sp|O94411|MFR2_SCHPO Meiotic fizzy-related protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfr2 PE=1 SV=1 280 676 4.0E-43
sp|P50082|AMA1_YEAST Meiosis-specific APC/C activator protein AMA1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AMA1 PE=1 SV=2 280 676 3.0E-42
sp|P78972|SLP1_SCHPO WD repeat-containing protein slp1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=slp1 PE=1 SV=1 212 649 3.0E-28
sp|Q54MZ3|CDC20_DICDI Anaphase-promoting complex subunit cdc20 OS=Dictyostelium discoideum GN=cdc20 PE=1 SV=1 280 654 3.0E-27
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q09786|YA98_SCHPO Uncharacterized WD repeat-containing protein C13G6.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC13G6.08 PE=3 SV=1 211 676 2.0E-49
sp|O94411|MFR2_SCHPO Meiotic fizzy-related protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfr2 PE=1 SV=1 280 676 4.0E-43
sp|P50082|AMA1_YEAST Meiosis-specific APC/C activator protein AMA1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AMA1 PE=1 SV=2 280 676 3.0E-42
sp|P78972|SLP1_SCHPO WD repeat-containing protein slp1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=slp1 PE=1 SV=1 212 649 3.0E-28
sp|Q54MZ3|CDC20_DICDI Anaphase-promoting complex subunit cdc20 OS=Dictyostelium discoideum GN=cdc20 PE=1 SV=1 280 654 3.0E-27
sp|Q9JJ66|CDC20_MOUSE Cell division cycle protein 20 homolog OS=Mus musculus GN=Cdc20 PE=1 SV=2 274 664 4.0E-25
sp|Q62623|CDC20_RAT Cell division cycle protein 20 homolog OS=Rattus norvegicus GN=Cdc20 PE=1 SV=2 274 653 2.0E-24
sp|Q12834|CDC20_HUMAN Cell division cycle protein 20 homolog OS=Homo sapiens GN=CDC20 PE=1 SV=2 274 664 4.0E-23
sp|Q9S7I8|CDC22_ARATH Cell division cycle 20.2, cofactor of APC complex OS=Arabidopsis thaliana GN=CDC20-2 PE=1 SV=1 436 649 2.0E-22
sp|Q9SZA4|CDC21_ARATH Cell division cycle 20.1, cofactor of APC complex OS=Arabidopsis thaliana GN=CDC20-1 PE=1 SV=1 436 649 2.0E-22
sp|Q5H7C0|CDC20_PIG Cell division cycle protein 20 homolog OS=Sus scrofa GN=CDC20 PE=2 SV=1 274 664 4.0E-22
sp|Q8LPL5|FZR3_ARATH Protein FIZZY-RELATED 3 OS=Arabidopsis thaliana GN=FZR3 PE=1 SV=1 429 663 6.0E-22
sp|Q54KM3|CDH1_DICDI Anaphase-promoting complex subunit cdh1 OS=Dictyostelium discoideum GN=cdh1 PE=3 SV=1 436 624 2.0E-21
sp|Q8L3Z8|FZR2_ARATH Protein FIZZY-RELATED 2 OS=Arabidopsis thaliana GN=FZR2 PE=1 SV=1 280 649 3.0E-21
sp|Q9UM11|FZR_HUMAN Fizzy-related protein homolog OS=Homo sapiens GN=FZR1 PE=1 SV=2 432 650 4.0E-21
sp|Q9R1K5|FZR_MOUSE Fizzy-related protein homolog OS=Mus musculus GN=Fzr1 PE=1 SV=1 432 650 5.0E-21
sp|Q8VZS9|FZR1_ARATH Protein FIZZY-RELATED 1 OS=Arabidopsis thaliana GN=FZR1 PE=1 SV=1 430 649 1.0E-20
sp|Q3E906|CD205_ARATH Cell division cycle 20.5, cofactor of APC complex OS=Arabidopsis thaliana GN=CDC20-5 PE=1 SV=2 436 653 2.0E-20
sp|F4K5R6|CDC26_ARATH Cell division cycle 20.6, cofactor of APC complex OS=Arabidopsis thaliana GN=CDC20-6 PE=3 SV=1 436 653 3.0E-19
sp|O13286|SRW1_SCHPO WD repeat-containing protein srw1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=srw1 PE=1 SV=1 280 657 7.0E-19
sp|Q9S7H3|CD203_ARATH Cell division cycle 20.3, cofactor of APC complex OS=Arabidopsis thaliana GN=CDC20-3 PE=3 SV=1 436 661 1.0E-18
sp|Q4PSE4|CDC24_ARATH Cell division cycle 20.4, cofactor of APC complex OS=Arabidopsis thaliana GN=CDC20-4 PE=2 SV=1 436 653 3.0E-18
sp|P26309|CDC20_YEAST APC/C activator protein CDC20 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC20 PE=1 SV=2 213 649 7.0E-18
sp|Q86Y33|CD20B_HUMAN Cell division cycle protein 20 homolog B OS=Homo sapiens GN=CDC20B PE=1 SV=3 280 589 3.0E-17
sp|O94423|MFR1_SCHPO Meiotic fizzy-related protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfr1 PE=1 SV=1 280 655 3.0E-17
sp|P53197|CDH1_YEAST APC/C activator protein CDH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDH1 PE=1 SV=1 280 656 2.0E-14
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5142
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|386 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|8162
Ophiocordyceps camponoti-rufipedis Ophun1|1532
Ophiocordyceps kimflemingae Ophio5|8027
Ophiocordyceps subramaniannii Hirsu2|3522

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|386
MARKASHERRQQQNEHDWTRLAPLSRQAVKNNVASPIDSGYGSGEASPSPRPRQARALDGTASCDEPEATPKAKR
RQQGDVEDRHVWSESRRRNSGSARMLNRFVPFWDPSATTTERYQTAKQTRALSPTERLVRHGAVSVDPFSPRRRP
ANIQASDTTALLSWNGTRRRRQQYQAGVDDGHGHLLRRGTNARLFTMSSLAASPSAQDELENYHDRVASALDIDR
VRRILSFSLRLPKPPCLEVPQESIQKTGDSRQWSWPKAQQGAESPRPSESRTLPYCSILAYSATCQILAVGLGNV
LYTWSEGMGVRTINGTQTAAVWLTCIAFSSPQGNKNILAAGRSDGSLVLKTVDDGLGRFVLRHGCSVTCLSWRPR
CVLRPSRNPLNPDVVVQTEHLVVGDELGNLYYYNVEWPMNWEISRDTWPGCIVLVAKLSLHCQQICGLAWSPDGS
LLASGGNDNLCCLFDIDETVDLLPELEGLVVTESGAVTVMGHGSPVWDNVHTLGPGCELQVWVHGAAVKAMAFCP
WRDGLVATGGGSNDKCIHFFHASTGSALATIAVAAQVTSLIWSTTRREIAATFGYAQPEHPYRVAVFSWPDCCQV
AAIPWDTDLRALYAIPYPWTSGQTKGCFDADGCIVVASSDETVKFHQVWSAQPRKVAVAGSGLLGGSDILEDLEG
VIKEGDVIR*
Coding >OphauG2|386
ATGGCACGAAAAGCATCCCATGAGAGACGGCAGCAGCAGAATGAACACGACTGGACAAGGCTTGCCCCTTTGAGC
CGGCAGGCTGTCAAGAACAACGTGGCAAGCCCAATCGACTCTGGGTACGGATCTGGAGAAGCATCGCCGTCGCCG
CGGCCAAGACAAGCTCGTGCCCTGGATGGCACTGCCTCTTGTGATGAGCCAGAGGCAACGCCTAAAGCAAAAAGA
AGACAGCAAGGCGACGTCGAAGACAGACATGTGTGGAGCGAGTCGAGACGGCGCAACAGTGGCAGCGCGCGCATG
CTCAACAGATTTGTCCCCTTTTGGGACCCTTCGGCAACGACAACGGAGCGATACCAGACAGCCAAGCAGACGCGG
GCCTTGTCCCCGACGGAGAGACTGGTGAGGCATGGCGCAGTCTCTGTCGATCCCTTTTCCCCGCGGCGCCGGCCG
GCAAATATCCAAGCATCGGACACGACGGCGCTGCTGTCTTGGAACGGGACTCGACGACGACGGCAACAGTATCAG
GCGGGTGTTGACGATGGCCACGGCCACCTGCTCAGGCGCGGGACCAATGCCCGCCTCTTCACCATGTCTTCGCTT
GCTGCTAGTCCAAGTGCGCAGGACGAGCTTGAGAACTACCACGACCGCGTGGCGTCTGCCCTTGACATTGATCGG
GTTCGGAGAATTCTCAGCTTTAGCCTGCGTCTGCCAAAGCCGCCGTGTCTGGAAGTGCCCCAGGAGAGCATACAA
AAGACTGGGGACAGCAGACAATGGAGCTGGCCCAAGGCTCAACAGGGTGCAGAGTCTCCCCGGCCGTCTGAGAGC
AGGACACTGCCGTACTGCTCGATACTGGCCTACTCGGCCACGTGCCAGATTCTTGCCGTCGGGCTGGGCAATGTG
CTCTACACGTGGTCCGAGGGCATGGGCGTGCGAACAATCAATGGCACACAGACGGCTGCCGTCTGGCTGACGTGC
ATTGCCTTTTCTTCGCCCCAAGGCAACAAGAACATCCTGGCGGCAGGCCGGTCTGACGGGTCGCTGGTGCTCAAG
ACGGTCGATGACGGCCTCGGGCGCTTCGTGCTTCGACATGGCTGCTCCGTCACTTGCCTGAGCTGGCGCCCTCGC
TGCGTCTTGCGGCCGTCGCGCAACCCGCTCAACCCAGACGTTGTGGTGCAGACGGAGCATCTGGTTGTTGGCGAC
GAATTGGGGAACCTCTATTACTACAATGTCGAGTGGCCCATGAACTGGGAGATTTCGCGAGACACATGGCCCGGA
TGCATTGTGCTCGTTGCCAAGCTCTCGCTGCATTGCCAACAAATCTGCGGCCTGGCCTGGTCGCCCGACGGCAGT
CTGCTGGCCTCTGGAGGCAACGACAACCTCTGCTGTCTGTTTGACATTGACGAGACGGTTGACCTGCTGCCCGAG
CTGGAGGGGCTCGTGGTGACCGAGTCAGGCGCCGTGACAGTCATGGGGCATGGCAGCCCAGTGTGGGACAATGTG
CACACTCTAGGCCCTGGCTGTGAGCTCCAGGTCTGGGTCCATGGCGCCGCCGTCAAGGCCATGGCCTTTTGCCCC
TGGCGCGACGGGCTTGTGGCGACGGGGGGCGGCTCCAACGACAAGTGCATCCACTTCTTCCATGCCTCGACGGGT
TCGGCGCTGGCAACCATTGCTGTTGCGGCACAGGTGACTTCGCTCATTTGGTCGACGACTCGCCGCGAGATTGCT
GCCACGTTTGGCTACGCTCAGCCCGAGCACCCCTACAGAGTCGCTGTTTTCAGCTGGCCCGACTGCTGCCAGGTG
GCCGCCATTCCCTGGGACACAGACTTGCGCGCCCTCTATGCCATTCCTTACCCTTGGACTTCGGGCCAGACCAAG
GGCTGCTTCGATGCAGACGGCTGTATTGTCGTTGCTTCGAGCGATGAAACGGTCAAGTTTCACCAGGTTTGGTCG
GCCCAGCCACGCAAAGTGGCGGTCGCCGGCTCTGGCCTTTTGGGTGGCAGCGACATTCTTGAGGACTTGGAGGGC
GTCATCAAGGAGGGAGACGTTATCCGTTGA
Transcript >OphauG2|386
ATGGCACGAAAAGCATCCCATGAGAGACGGCAGCAGCAGAATGAACACGACTGGACAAGGCTTGCCCCTTTGAGC
CGGCAGGCTGTCAAGAACAACGTGGCAAGCCCAATCGACTCTGGGTACGGATCTGGAGAAGCATCGCCGTCGCCG
CGGCCAAGACAAGCTCGTGCCCTGGATGGCACTGCCTCTTGTGATGAGCCAGAGGCAACGCCTAAAGCAAAAAGA
AGACAGCAAGGCGACGTCGAAGACAGACATGTGTGGAGCGAGTCGAGACGGCGCAACAGTGGCAGCGCGCGCATG
CTCAACAGATTTGTCCCCTTTTGGGACCCTTCGGCAACGACAACGGAGCGATACCAGACAGCCAAGCAGACGCGG
GCCTTGTCCCCGACGGAGAGACTGGTGAGGCATGGCGCAGTCTCTGTCGATCCCTTTTCCCCGCGGCGCCGGCCG
GCAAATATCCAAGCATCGGACACGACGGCGCTGCTGTCTTGGAACGGGACTCGACGACGACGGCAACAGTATCAG
GCGGGTGTTGACGATGGCCACGGCCACCTGCTCAGGCGCGGGACCAATGCCCGCCTCTTCACCATGTCTTCGCTT
GCTGCTAGTCCAAGTGCGCAGGACGAGCTTGAGAACTACCACGACCGCGTGGCGTCTGCCCTTGACATTGATCGG
GTTCGGAGAATTCTCAGCTTTAGCCTGCGTCTGCCAAAGCCGCCGTGTCTGGAAGTGCCCCAGGAGAGCATACAA
AAGACTGGGGACAGCAGACAATGGAGCTGGCCCAAGGCTCAACAGGGTGCAGAGTCTCCCCGGCCGTCTGAGAGC
AGGACACTGCCGTACTGCTCGATACTGGCCTACTCGGCCACGTGCCAGATTCTTGCCGTCGGGCTGGGCAATGTG
CTCTACACGTGGTCCGAGGGCATGGGCGTGCGAACAATCAATGGCACACAGACGGCTGCCGTCTGGCTGACGTGC
ATTGCCTTTTCTTCGCCCCAAGGCAACAAGAACATCCTGGCGGCAGGCCGGTCTGACGGGTCGCTGGTGCTCAAG
ACGGTCGATGACGGCCTCGGGCGCTTCGTGCTTCGACATGGCTGCTCCGTCACTTGCCTGAGCTGGCGCCCTCGC
TGCGTCTTGCGGCCGTCGCGCAACCCGCTCAACCCAGACGTTGTGGTGCAGACGGAGCATCTGGTTGTTGGCGAC
GAATTGGGGAACCTCTATTACTACAATGTCGAGTGGCCCATGAACTGGGAGATTTCGCGAGACACATGGCCCGGA
TGCATTGTGCTCGTTGCCAAGCTCTCGCTGCATTGCCAACAAATCTGCGGCCTGGCCTGGTCGCCCGACGGCAGT
CTGCTGGCCTCTGGAGGCAACGACAACCTCTGCTGTCTGTTTGACATTGACGAGACGGTTGACCTGCTGCCCGAG
CTGGAGGGGCTCGTGGTGACCGAGTCAGGCGCCGTGACAGTCATGGGGCATGGCAGCCCAGTGTGGGACAATGTG
CACACTCTAGGCCCTGGCTGTGAGCTCCAGGTCTGGGTCCATGGCGCCGCCGTCAAGGCCATGGCCTTTTGCCCC
TGGCGCGACGGGCTTGTGGCGACGGGGGGCGGCTCCAACGACAAGTGCATCCACTTCTTCCATGCCTCGACGGGT
TCGGCGCTGGCAACCATTGCTGTTGCGGCACAGGTGACTTCGCTCATTTGGTCGACGACTCGCCGCGAGATTGCT
GCCACGTTTGGCTACGCTCAGCCCGAGCACCCCTACAGAGTCGCTGTTTTCAGCTGGCCCGACTGCTGCCAGGTG
GCCGCCATTCCCTGGGACACAGACTTGCGCGCCCTCTATGCCATTCCTTACCCTTGGACTTCGGGCCAGACCAAG
GGCTGCTTCGATGCAGACGGCTGTATTGTCGTTGCTTCGAGCGATGAAACGGTCAAGTTTCACCAGGTTTGGTCG
GCCCAGCCACGCAAAGTGGCGGTCGCCGGCTCTGGCCTTTTGGGTGGCAGCGACATTCTTGAGGACTTGGAGGGC
GTCATCAAGGAGGGAGACGTTATCCGTTGA
Gene >OphauG2|386
ATGGCACGAAAAGCATCCCATGAGAGACGGCAGCAGCAGAATGAACACGACTGGACAAGGCTTGCCCCTTTGAGC
CGGCAGGCTGTCAAGAACAACGTGGCAAGCCCAATCGACTCTGGGTACGGATCTGGAGAAGCATCGCCGTCGCCG
CGGCCAAGACAAGCTCGTGCCCTGGATGGCACTGCCTCTTGTGATGAGCCAGAGGCAACGCCTAAAGCAAAAAGA
AGACAGCAAGGCGACGTCGAAGACAGACATGTGTGGAGCGAGTCGAGACGGCGCAACAGTGGCAGCGCGCGCATG
CTCAACAGATTTGTCCCCTTTTGGGACCCTTCGGCAACGACAACGGAGCGATACCAGACAGCCAAGCAGACGCGG
GCCTTGTCCCCGACGGAGAGACTGGTGAGGCATGGCGCAGTCTCTGTCGATCCCTTTTCCCCGCGGCGCCGGCCG
GCAAATATCCAAGCATCGGACACGACGGCGCTGCTGTCTTGGAACGGGACTCGACGACGACGGCAACAGTATCAG
GCGGGTGTTGACGATGGCCACGGCCACCTGCTCAGGCGCGGGACCAATGCCCGCCTCTTCACCATGTCTTCGCTT
GCTGCTAGTCCAAGTGCGCAGGACGAGCTTGAGAACTACCACGACCGCGTGGCGTCTGCCCTTGACATTGATCGG
GTTCGGAGAATTCTCAGCTTTAGCCTGCGTCTGCCAAAGCCGCCGTGTCTGGAAGTGCCCCAGGAGAGCATACAA
AAGACTGGGGACAGCAGACAATGGAGCTGGCCCAAGGCTCAACAGGGTGGTGAGTGGCGCTCGAGGCGCTTGTGG
CGCGCCAGGTGGCTGACGCCGGGTTGCAGCAGAGTCTCCCCGGCCGTCTGAGAGCAGGACACTGCCGGTTGCGCC
CTTCAGGTAGTCCCGATGCCCTGGCACAGGCCTGCAAGACGAGGCTAATTGGCTCAGGGTGCTGGATGCTCCAGG
CTTGCGAGACGACTAGTACTGCTCGATACTGGCCTACTCGGCCACGTGCCAGATTCTTGCCGTCGGGCTGGGCAA
TGTGCTCTACACGTGGTCCGAGGGCATGGGCGTGCGAACAATCAATGGCACACAGACGGCTGCCGTCTGGCTGAC
GTGCATTGCCTTTTCTTCGCCCCAAGGCAACAAGAACATCCTGGCGGCAGGCCGGTCTGACGGGTCGCTGGTGCT
CAAGACGGTCGATGACGGCCTCGGGCGCTTCGTGCTTCGACATGGCTGCTCCGTCACTTGCCTGAGCTGGCGCCC
TCGCTGCGTCTTGCGGCCGTCGCGCAACCCGCTCAACCCAGACGTTGTGGTGCAGACGGAGCATCTGGTTGTTGG
CGACGAATTGGGGAACCTCTATTACTACAATGTCGAGTGGCCCATGAACTGGGAGATTTCGCGAGACACATGGCC
CGGATGCATTGTGCTCGTTGCCAAGCTCTCGCTGCATTGCCAACAAATCTGCGGCCTGGCCTGGTCGCCCGACGG
CAGTCTGCTGGCCTCTGGAGGCAACGACAACCTCTGCTGTCTGTTTGACATTGACGAGACGGTTGACCTGCTGCC
CGAGCTGGAGGGGCTCGTGGTGACCGAGTCAGGCGCCGTGACAGTCATGGGGCATGGCAGCCCAGTGTGGGACAA
TGTGCACACTCTAGGCCCTGGCTGTGAGCTCCAGGTCTGGGTCCATGGCGCCGCCGTCAAGGCCATGGCCTTTTG
CCCCTGGCGCGACGGGCTTGTGGCGACGGGGGGCGGCTCCAACGACAAGTGCATCCACTTCTTCCATGCCTCGAC
GGGTTCGGCGCTGGCAACCATTGCTGTTGCGGCACAGGTGACTTCGCTCATTTGGTCGACGACTCGCCGCGAGAT
TGCTGCCACGTTTGGCTACGCTCAGCCCGAGCACCCCTACAGAGTCGCTGTTTTCAGCTGGCCCGACTGCTGCCA
GGTGGCCGCCATTCCCTGGGACACAGACTTGCGCGCCCTCTATGCCATTCCTTACCCTTGGACTTCGGGCCAGAC
CAAGGGCTGCTTCGATGCAGACGGCTGTATTGTCGTTGCTTCGAGCGATGAAACGGTCAAGTTTCACCAGGTTTG
GTCGGCCCAGCCACGCAAAGTGGCGGTCGCCGGCTCTGGCCTTTTGGGTGGCAGCGACATTCTTGAGGACTTGGA
GGGCGTCATCAAGGAGGGAGACGTTATCCGTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail