Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|3837
Gene name
LocationContig_30:10444..11398
Strand+
Gene length (bp)954
Transcript length (bp)954
Coding sequence length (bp)954
Protein length (aa) 318

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09377 SBDS_domain_II SBDS protein, domain II 4.9E-37 112 211
PF01172 SBDS Shwachman-Bodian-Diamond syndrome (SBDS) protein 2.7E-32 16 103
PF20268 SBDS_C SBDS protein, C-terminal domain 6.0E-29 213 311

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O14179|SDO1_SCHPO Ribosome maturation protein sdo1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sdo1 PE=3 SV=1 5 312 8.0E-59
sp|Q6DIT8|SBDS_XENTR Ribosome maturation protein SBDS OS=Xenopus tropicalis GN=sbds PE=2 SV=1 5 311 1.0E-55
sp|Q5RAZ2|SBDS_PONAB Ribosome maturation protein SBDS OS=Pongo abelii GN=SBDS PE=2 SV=1 5 311 2.0E-54
sp|Q9Y3A5|SBDS_HUMAN Ribosome maturation protein SBDS OS=Homo sapiens GN=SBDS PE=1 SV=4 5 311 2.0E-54
sp|Q5RK30|SBDS_RAT Ribosome maturation protein SBDS OS=Rattus norvegicus GN=Sbds PE=2 SV=1 5 311 5.0E-54
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O14179|SDO1_SCHPO Ribosome maturation protein sdo1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sdo1 PE=3 SV=1 5 312 8.0E-59
sp|Q6DIT8|SBDS_XENTR Ribosome maturation protein SBDS OS=Xenopus tropicalis GN=sbds PE=2 SV=1 5 311 1.0E-55
sp|Q5RAZ2|SBDS_PONAB Ribosome maturation protein SBDS OS=Pongo abelii GN=SBDS PE=2 SV=1 5 311 2.0E-54
sp|Q9Y3A5|SBDS_HUMAN Ribosome maturation protein SBDS OS=Homo sapiens GN=SBDS PE=1 SV=4 5 311 2.0E-54
sp|Q5RK30|SBDS_RAT Ribosome maturation protein SBDS OS=Rattus norvegicus GN=Sbds PE=2 SV=1 5 311 5.0E-54
sp|P70122|SBDS_MOUSE Ribosome maturation protein SBDS OS=Mus musculus GN=Sbds PE=1 SV=4 5 311 6.0E-54
sp|A5D8M6|SBDS_XENLA Ribosome maturation protein SBDS OS=Xenopus laevis GN=sbds PE=2 SV=1 5 311 7.0E-54
sp|Q3SWZ6|SBDS_BOVIN Ribosome maturation protein SBDS OS=Bos taurus GN=SBDS PE=2 SV=1 5 311 1.0E-53
sp|Q07953|SDO1_YEAST Ribosome maturation protein SDO1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SDO1 PE=1 SV=1 5 313 3.0E-53
sp|Q5ZIY4|SBDS_CHICK Ribosome maturation protein SBDS OS=Gallus gallus GN=SBDS PE=2 SV=1 5 311 8.0E-51
sp|Q23202|SBDS_CAEEL Ribosome maturation protein SBDS OS=Caenorhabditis elegans GN=sbds-1 PE=3 SV=2 1 311 7.0E-48
sp|Q86KZ5|SBDS_DICDI Ribosome maturation protein SBDS OS=Dictyostelium discoideum GN=sbds PE=3 SV=2 5 316 2.0E-45
sp|Q8SUL0|SDO1_ENCCU Ribosome maturation protein SDO1 OS=Encephalitozoon cuniculi (strain GB-M1) GN=SDO1 PE=1 SV=1 8 122 3.0E-14
sp|Q9YCU5|SDO1_AERPE Ribosome maturation protein SDO1 homolog OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=APE_1167.1 PE=3 SV=2 27 222 8.0E-12
sp|O29759|SDO1_ARCFU Ribosome maturation protein SDO1 homolog OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=AF_0491 PE=1 SV=1 12 141 9.0E-10
sp|Q9V121|SDO1_PYRAB Ribosome maturation protein SDO1 homolog OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=PYRAB06080 PE=3 SV=1 12 152 9.0E-09
sp|O59220|SDO1_PYRHO Ribosome maturation protein SDO1 homolog OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=PH1552 PE=3 SV=1 12 152 4.0E-08
sp|Q58011|SDO1_METJA Ribosome maturation protein SDO1 homolog OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0592 PE=3 SV=1 12 143 4.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0042254 ribosome biogenesis Yes
GO:0022613 ribonucleoprotein complex biogenesis No
GO:0071840 cellular component organization or biogenesis No
GO:0008150 biological_process No
GO:0044085 cellular component biogenesis No
GO:0009987 cellular process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1885
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3837 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|5679
Ophiocordyceps camponoti-floridani Ophcf2|05018
Ophiocordyceps camponoti-rufipedis Ophun1|3464
Ophiocordyceps kimflemingae Ophio5|3954
Ophiocordyceps subramaniannii Hirsu2|1937

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|3837
MSRQINQPSNQIKLTNVSLVRLKKGKKRFEIACYKNKVLEWRSGIETNLDNVLQIPNVFLNVSKGQTAPKEDVEK
AFGKDRPINDVILDILKKGELQVGDKERAAQLQRVHNEVIAIVASKLVDPRTKRVYTSGMIEKALDMLSSQAHAN
QDKDKPASGAGTPTAGDDAEAKPRPREHSWTGVVTAKSAKSQALEAMKALIAFQPIPVARARMRLRISCPTNVLK
QAIKTSSAASAGAKGNTANDAQTEQQKTPGTVKDKILGYVEQVENQDVMGSEWEVVGFVEPGAFKALSDFIANET
KGQGRVEVLDMAVTHED*
Coding >OphauG2|3837
ATGTCCCGCCAAATCAACCAGCCTTCTAACCAAATCAAACTCACAAACGTCTCCCTTGTGCGGCTGAAAAAAGGC
AAGAAGCGATTCGAAATCGCCTGCTACAAGAACAAGGTCCTTGAATGGCGCTCCGGCATCGAGACCAACCTAGAC
AACGTCTTGCAAATCCCAAACGTCTTTCTCAACGTGTCCAAGGGCCAGACGGCTCCCAAGGAGGATGTTGAAAAG
GCCTTTGGCAAAGACCGGCCCATCAACGACGTCATACTCGACATCCTCAAAAAGGGCGAGCTCCAGGTTGGTGAC
AAGGAGCGCGCCGCTCAGCTCCAACGCGTCCACAATGAAGTCATTGCCATCGTCGCCAGCAAGCTCGTGGACCCT
CGCACAAAGCGTGTGTATACTTCGGGCATGATAGAAAAGGCTCTCGACATGCTCAGCTCTCAAGCCCATGCCAAT
CAAGACAAAGACAAGCCCGCCAGTGGCGCCGGCACACCCACGGCAGGCGACGATGCTGAAGCAAAGCCGCGCCCG
AGGGAGCACAGCTGGACCGGTGTCGTTACCGCCAAAAGCGCAAAAAGCCAAGCGCTCGAAGCCATGAAGGCCTTG
ATTGCCTTTCAACCAATACCTGTTGCCCGAGCAAGGATGCGATTGCGTATTTCATGTCCGACCAATGTGCTCAAA
CAAGCCATCAAGACGTCAAGCGCTGCATCCGCTGGTGCCAAGGGCAATACCGCAAACGACGCGCAGACAGAGCAG
CAAAAGACACCAGGCACAGTCAAGGACAAAATACTCGGTTACGTCGAACAAGTCGAAAATCAAGATGTCATGGGA
TCAGAATGGGAAGTCGTGGGCTTTGTCGAGCCCGGCGCTTTCAAGGCCTTGTCCGACTTTATTGCAAACGAGACC
AAGGGCCAAGGCAGGGTAGAAGTGCTGGACATGGCAGTGACACATGAGGATTGA
Transcript >OphauG2|3837
ATGTCCCGCCAAATCAACCAGCCTTCTAACCAAATCAAACTCACAAACGTCTCCCTTGTGCGGCTGAAAAAAGGC
AAGAAGCGATTCGAAATCGCCTGCTACAAGAACAAGGTCCTTGAATGGCGCTCCGGCATCGAGACCAACCTAGAC
AACGTCTTGCAAATCCCAAACGTCTTTCTCAACGTGTCCAAGGGCCAGACGGCTCCCAAGGAGGATGTTGAAAAG
GCCTTTGGCAAAGACCGGCCCATCAACGACGTCATACTCGACATCCTCAAAAAGGGCGAGCTCCAGGTTGGTGAC
AAGGAGCGCGCCGCTCAGCTCCAACGCGTCCACAATGAAGTCATTGCCATCGTCGCCAGCAAGCTCGTGGACCCT
CGCACAAAGCGTGTGTATACTTCGGGCATGATAGAAAAGGCTCTCGACATGCTCAGCTCTCAAGCCCATGCCAAT
CAAGACAAAGACAAGCCCGCCAGTGGCGCCGGCACACCCACGGCAGGCGACGATGCTGAAGCAAAGCCGCGCCCG
AGGGAGCACAGCTGGACCGGTGTCGTTACCGCCAAAAGCGCAAAAAGCCAAGCGCTCGAAGCCATGAAGGCCTTG
ATTGCCTTTCAACCAATACCTGTTGCCCGAGCAAGGATGCGATTGCGTATTTCATGTCCGACCAATGTGCTCAAA
CAAGCCATCAAGACGTCAAGCGCTGCATCCGCTGGTGCCAAGGGCAATACCGCAAACGACGCGCAGACAGAGCAG
CAAAAGACACCAGGCACAGTCAAGGACAAAATACTCGGTTACGTCGAACAAGTCGAAAATCAAGATGTCATGGGA
TCAGAATGGGAAGTCGTGGGCTTTGTCGAGCCCGGCGCTTTCAAGGCCTTGTCCGACTTTATTGCAAACGAGACC
AAGGGCCAAGGCAGGGTAGAAGTGCTGGACATGGCAGTGACACATGAGGATTGA
Gene >OphauG2|3837
ATGTCCCGCCAAATCAACCAGCCTTCTAACCAAATCAAACTCACAAACGTCTCCCTTGTGCGGCTGAAAAAAGGC
AAGAAGCGATTCGAAATCGCCTGCTACAAGAACAAGGTCCTTGAATGGCGCTCCGGCATCGAGACCAACCTAGAC
AACGTCTTGCAAATCCCAAACGTCTTTCTCAACGTGTCCAAGGGCCAGACGGCTCCCAAGGAGGATGTTGAAAAG
GCCTTTGGCAAAGACCGGCCCATCAACGACGTCATACTCGACATCCTCAAAAAGGGCGAGCTCCAGGTTGGTGAC
AAGGAGCGCGCCGCTCAGCTCCAACGCGTCCACAATGAAGTCATTGCCATCGTCGCCAGCAAGCTCGTGGACCCT
CGCACAAAGCGTGTGTATACTTCGGGCATGATAGAAAAGGCTCTCGACATGCTCAGCTCTCAAGCCCATGCCAAT
CAAGACAAAGACAAGCCCGCCAGTGGCGCCGGCACACCCACGGCAGGCGACGATGCTGAAGCAAAGCCGCGCCCG
AGGGAGCACAGCTGGACCGGTGTCGTTACCGCCAAAAGCGCAAAAAGCCAAGCGCTCGAAGCCATGAAGGCCTTG
ATTGCCTTTCAACCAATACCTGTTGCCCGAGCAAGGATGCGATTGCGTATTTCATGTCCGACCAATGTGCTCAAA
CAAGCCATCAAGACGTCAAGCGCTGCATCCGCTGGTGCCAAGGGCAATACCGCAAACGACGCGCAGACAGAGCAG
CAAAAGACACCAGGCACAGTCAAGGACAAAATACTCGGTTACGTCGAACAAGTCGAAAATCAAGATGTCATGGGA
TCAGAATGGGAAGTCGTGGGCTTTGTCGAGCCCGGCGCTTTCAAGGCCTTGTCCGACTTTATTGCAAACGAGACC
AAGGGCCAAGGCAGGGTAGAAGTGCTGGACATGGCAGTGACACATGAGGATTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail