Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|3836
Gene name
LocationContig_30:8338..10140
Strand-
Gene length (bp)1802
Transcript length (bp)1434
Coding sequence length (bp)1434
Protein length (aa) 478

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00579 tRNA-synt_1b tRNA synthetases class I (W and Y) 8.4E-20 94 379

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q09692|SYWC_SCHPO Tryptophan--tRNA ligase, cytoplasmic OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=wrs1 PE=1 SV=1 19 413 6.0E-170
sp|Q12109|SYWC_YEAST Tryptophan--tRNA ligase, cytoplasmic OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=WRS1 PE=1 SV=1 19 413 3.0E-166
sp|P23612|SYWC_RABIT Tryptophan--tRNA ligase, cytoplasmic OS=Oryctolagus cuniculus GN=WARS PE=2 SV=3 7 411 3.0E-159
sp|Q5R4J1|SYWC_PONAB Tryptophan--tRNA ligase, cytoplasmic OS=Pongo abelii GN=WARS PE=2 SV=2 7 413 4.0E-156
sp|P23381|SYWC_HUMAN Tryptophan--tRNA ligase, cytoplasmic OS=Homo sapiens GN=WARS PE=1 SV=2 7 413 3.0E-155
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q09692|SYWC_SCHPO Tryptophan--tRNA ligase, cytoplasmic OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=wrs1 PE=1 SV=1 19 413 6.0E-170
sp|Q12109|SYWC_YEAST Tryptophan--tRNA ligase, cytoplasmic OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=WRS1 PE=1 SV=1 19 413 3.0E-166
sp|P23612|SYWC_RABIT Tryptophan--tRNA ligase, cytoplasmic OS=Oryctolagus cuniculus GN=WARS PE=2 SV=3 7 411 3.0E-159
sp|Q5R4J1|SYWC_PONAB Tryptophan--tRNA ligase, cytoplasmic OS=Pongo abelii GN=WARS PE=2 SV=2 7 413 4.0E-156
sp|P23381|SYWC_HUMAN Tryptophan--tRNA ligase, cytoplasmic OS=Homo sapiens GN=WARS PE=1 SV=2 7 413 3.0E-155
sp|P17248|SYWC_BOVIN Tryptophan--tRNA ligase, cytoplasmic OS=Bos taurus GN=WARS PE=1 SV=3 7 413 4.0E-155
sp|Q6P7B0|SYWC_RAT Tryptophan--tRNA ligase, cytoplasmic OS=Rattus norvegicus GN=Wars PE=1 SV=2 13 413 6.0E-154
sp|P32921|SYWC_MOUSE Tryptophan--tRNA ligase, cytoplasmic OS=Mus musculus GN=Wars PE=1 SV=2 17 413 2.0E-152
sp|Q9SR15|SYWC_ARATH Tryptophan--tRNA ligase, cytoplasmic OS=Arabidopsis thaliana GN=At3g04600 PE=2 SV=1 15 411 2.0E-143
sp|Q55DZ8|SYWC_DICDI Tryptophan--tRNA ligase, cytoplasmic OS=Dictyostelium discoideum GN=trpS PE=3 SV=1 20 413 3.0E-133
sp|O96771|SYW_ENCCU Tryptophan--tRNA ligase OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU11_0530 PE=1 SV=2 18 406 6.0E-115
sp|Q4JBG7|SYW_SULAC Tryptophan--tRNA ligase OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=trpS PE=3 SV=1 22 401 2.0E-102
sp|Q976M1|SYW_SULTO Tryptophan--tRNA ligase OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=trpS PE=3 SV=2 21 401 5.0E-100
sp|Q97ZX0|SYW_SULSO Tryptophan--tRNA ligase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=trpS PE=3 SV=2 22 387 5.0E-98
sp|Q8U453|SYW_PYRFU Tryptophan--tRNA ligase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=trpS PE=3 SV=1 22 405 1.0E-94
sp|C6A032|SYW_THESM Tryptophan--tRNA ligase OS=Thermococcus sibiricus (strain MM 739 / DSM 12597) GN=trpS PE=3 SV=1 21 401 2.0E-91
sp|Q9UY11|SYW_PYRAB Tryptophan--tRNA ligase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=trpS PE=3 SV=1 22 401 3.0E-89
sp|O59584|SYW_PYRHO Tryptophan--tRNA ligase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=trpS PE=1 SV=2 22 405 7.0E-88
sp|B6YUH1|SYW_THEON Tryptophan--tRNA ligase OS=Thermococcus onnurineus (strain NA1) GN=trpS PE=3 SV=1 22 428 9.0E-87
sp|Q5JEP3|SYW_THEKO Tryptophan--tRNA ligase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=trpS PE=3 SV=1 22 428 1.0E-84
sp|A3MX72|SYW_PYRCJ Tryptophan--tRNA ligase OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=trpS PE=3 SV=1 22 401 5.0E-82
sp|A4WL99|SYW_PYRAR Tryptophan--tRNA ligase OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=trpS PE=3 SV=1 22 405 2.0E-81
sp|Q8ZTU5|SYW_PYRAE Tryptophan--tRNA ligase OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=trpS PE=3 SV=1 22 405 1.0E-78
sp|Q9HN66|SYW2_HALSA Tryptophan--tRNA ligase 2 OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=trpS2 PE=3 SV=1 20 400 3.0E-58
sp|Q8TYF7|SYW_METKA Tryptophan--tRNA ligase OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=trpS PE=3 SV=1 22 403 5.0E-46
sp|Q58810|SYW_METJA Tryptophan--tRNA ligase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=trpS PE=3 SV=1 21 402 6.0E-44
sp|O26352|SYW_METTH Tryptophan--tRNA ligase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=trpS PE=3 SV=1 22 396 4.0E-42
sp|A2BLD4|SYW_HYPBU Tryptophan--tRNA ligase OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5) GN=trpS PE=3 SV=1 22 403 1.0E-39
sp|Q9Y924|SYW_AERPE Tryptophan--tRNA ligase OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=trpS PE=1 SV=2 18 414 6.0E-34
sp|Q8PWV5|SYW_METMA Tryptophan--tRNA ligase OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=trpS PE=3 SV=2 22 274 5.0E-21
sp|O28579|SYW_ARCFU Tryptophan--tRNA ligase OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=trpS PE=3 SV=1 21 270 9.0E-21
sp|Q8TUA1|SYW_METAC Tryptophan--tRNA ligase OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=trpS PE=3 SV=1 22 274 7.0E-17
sp|Q9HN83|SYW1_HALSA Tryptophan--tRNA ligase 1 OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=trpS1 PE=3 SV=1 22 269 6.0E-16
sp|O28579|SYW_ARCFU Tryptophan--tRNA ligase OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=trpS PE=3 SV=1 270 397 7.0E-13
sp|Q8TUA1|SYW_METAC Tryptophan--tRNA ligase OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=trpS PE=3 SV=1 270 394 9.0E-11
sp|Q8PWV5|SYW_METMA Tryptophan--tRNA ligase OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=trpS PE=3 SV=2 271 405 7.0E-10
sp|Q978Y8|SYW_THEVO Tryptophan--tRNA ligase OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=trpS PE=3 SV=1 22 274 2.0E-09
sp|Q8DWP7|SYW_STRA5 Tryptophan--tRNA ligase OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=trpS PE=3 SV=1 96 394 4.0E-08
sp|Q8E2J5|SYW_STRA3 Tryptophan--tRNA ligase OS=Streptococcus agalactiae serotype III (strain NEM316) GN=trpS PE=3 SV=1 96 394 4.0E-08
sp|Q9HN83|SYW1_HALSA Tryptophan--tRNA ligase 1 OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=trpS1 PE=3 SV=1 271 403 1.0E-07
sp|Q9HIW5|SYW_THEAC Tryptophan--tRNA ligase OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=trpS PE=3 SV=1 22 274 2.0E-07
sp|Q9CJD1|SYW_LACLA Tryptophan--tRNA ligase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=trpS PE=3 SV=1 100 394 1.0E-06
sp|Q9PJF5|SYW_CHLMU Tryptophan--tRNA ligase OS=Chlamydia muridarum (strain MoPn / Nigg) GN=trpS PE=3 SV=1 100 394 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0000166 nucleotide binding Yes
GO:0004812 aminoacyl-tRNA ligase activity Yes
GO:0006418 tRNA aminoacylation for protein translation Yes
GO:0006520 cellular amino acid metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0034660 ncRNA metabolic process No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0006399 tRNA metabolic process No
GO:0030554 adenyl nucleotide binding No
GO:0017076 purine nucleotide binding No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:1901265 nucleoside phosphate binding No
GO:0032553 ribonucleotide binding No
GO:0140098 catalytic activity, acting on RNA No
GO:0044281 small molecule metabolic process No
GO:0044238 primary metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0140101 catalytic activity, acting on a tRNA No
GO:0043436 oxoacid metabolic process No
GO:0006082 organic acid metabolic process No
GO:0043168 anion binding No
GO:0019752 carboxylic acid metabolic process No
GO:0043167 ion binding No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0097159 organic cyclic compound binding No
GO:1901360 organic cyclic compound metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0016070 RNA metabolic process No
GO:0032555 purine ribonucleotide binding No
GO:0003824 catalytic activity No
GO:0044237 cellular metabolic process No
GO:0097367 carbohydrate derivative binding No
GO:1901564 organonitrogen compound metabolic process No
GO:0032559 adenyl ribonucleotide binding No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0016874 ligase activity No
GO:0043038 amino acid activation No
GO:0003674 molecular_function No
GO:0090304 nucleic acid metabolic process No
GO:0016875 ligase activity, forming carbon-oxygen bonds No
GO:0036094 small molecule binding No
GO:0071704 organic substance metabolic process No
GO:0005488 binding No
GO:0006807 nitrogen compound metabolic process No
GO:0043039 tRNA aminoacylation No
GO:0043170 macromolecule metabolic process No
GO:0009987 cellular process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 40 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|3836
MASATHPEAAASPRAASSKQDVNPWSVSGEVGDDGKVKAIDYRKLVEEFGTTLIDDALLERFERVTGHKPHRFMR
RQIVFSHRDLSVILDRYEKNEPFFLYTGRGPSSDSMHIGHTQVFDFVKWLQDVLDVPLIIMLTDDEKFLFSEKRS
VQEVMGYTRTNAMDIIAIGFDPQKTFIFSDFEYVGGAFYKNIVRFSKRVTYNTVKAIFGFDGSSNIGKIHFASIQ
GATSFASSFPHIFGSDESKTASIPCLIPCAIDQDPYFRLTRDCAAGLHLAKPSLIHMRFLDALQGPGSKMSASDD
TSAIFLTDSSKQIKSKINKYAFSGGRETLEEHREKGGNADVDVAYQYLQFFLESDEQLAQIKADYNSGKLLTGEI
KAICIEYLQKYVSAFQDRRRKVTDTVVDEFMKARPLEWKGNTKVPRADLVVPETSGNAGAEGGAGESKLTKNQVK
KLLKEQQVAQKKADKAKEKAASGQAGT*
Coding >OphauG2|3836
ATGGCTTCTGCTACACACCCAGAGGCTGCAGCATCTCCTCGGGCAGCCTCGTCTAAACAGGACGTCAACCCGTGG
TCTGTATCGGGCGAAGTGGGCGACGACGGCAAGGTCAAGGCCATCGACTACCGCAAACTGGTGGAGGAATTTGGC
ACGACTCTGATTGACGATGCGCTGCTGGAACGCTTCGAGCGGGTGACGGGCCACAAGCCCCATCGCTTCATGCGC
CGACAAATTGTCTTTAGCCATCGTGATTTGTCCGTCATTCTCGATCGATATGAAAAGAATGAGCCCTTTTTCCTC
TATACTGGCCGTGGCCCGAGCAGCGACAGCATGCATATTGGCCACACGCAAGTTTTTGACTTTGTCAAGTGGCTG
CAAGACGTTTTGGATGTCCCATTGATCATCATGCTGACAGATGATGAAAAATTCCTCTTTTCTGAAAAGAGAAGC
GTGCAAGAAGTCATGGGCTACACCCGTACAAATGCAATGGATATTATCGCCATTGGCTTTGACCCCCAAAAGACG
TTCATCTTTTCCGACTTTGAGTACGTTGGGGGCGCCTTTTATAAGAACATTGTCCGCTTCTCCAAGAGGGTCACG
TATAACACGGTCAAGGCCATCTTTGGCTTCGATGGCAGTTCCAACATTGGCAAGATTCACTTTGCCAGTATTCAG
GGCGCAACGTCGTTTGCGTCTTCCTTTCCGCATATTTTTGGCAGCGACGAGTCAAAAACGGCATCGATTCCCTGC
TTGATTCCCTGTGCCATTGACCAGGACCCGTACTTTCGCTTGACACGGGACTGTGCTGCAGGACTGCATTTGGCG
AAGCCGTCTTTGATCCATATGCGGTTTTTGGATGCTTTACAGGGCCCCGGCTCCAAAATGTCGGCCAGTGACGAC
ACATCGGCCATTTTCCTCACCGATTCGTCGAAGCAAATAAAGTCAAAAATTAATAAATACGCCTTTTCTGGCGGC
AGAGAAACACTAGAGGAACACAGAGAAAAGGGCGGCAATGCCGATGTGGATGTTGCCTACCAATACCTGCAGTTT
TTCCTGGAAAGCGATGAGCAACTAGCTCAAATAAAGGCCGACTACAATAGCGGCAAGCTTCTTACAGGCGAGATC
AAGGCAATTTGTATCGAATACCTCCAAAAATATGTCAGTGCGTTCCAGGACAGAAGACGCAAAGTTACAGACACA
GTCGTGGACGAGTTTATGAAGGCGCGGCCTCTAGAGTGGAAGGGTAATACCAAGGTGCCACGAGCCGACCTTGTT
GTCCCTGAAACGAGTGGCAATGCGGGAGCGGAAGGCGGCGCTGGCGAGAGCAAGCTGACCAAGAACCAAGTGAAG
AAGTTACTCAAGGAGCAGCAGGTTGCGCAGAAGAAGGCGGACAAGGCCAAGGAGAAGGCGGCCAGTGGCCAAGCA
GGCACTTGA
Transcript >OphauG2|3836
ATGGCTTCTGCTACACACCCAGAGGCTGCAGCATCTCCTCGGGCAGCCTCGTCTAAACAGGACGTCAACCCGTGG
TCTGTATCGGGCGAAGTGGGCGACGACGGCAAGGTCAAGGCCATCGACTACCGCAAACTGGTGGAGGAATTTGGC
ACGACTCTGATTGACGATGCGCTGCTGGAACGCTTCGAGCGGGTGACGGGCCACAAGCCCCATCGCTTCATGCGC
CGACAAATTGTCTTTAGCCATCGTGATTTGTCCGTCATTCTCGATCGATATGAAAAGAATGAGCCCTTTTTCCTC
TATACTGGCCGTGGCCCGAGCAGCGACAGCATGCATATTGGCCACACGCAAGTTTTTGACTTTGTCAAGTGGCTG
CAAGACGTTTTGGATGTCCCATTGATCATCATGCTGACAGATGATGAAAAATTCCTCTTTTCTGAAAAGAGAAGC
GTGCAAGAAGTCATGGGCTACACCCGTACAAATGCAATGGATATTATCGCCATTGGCTTTGACCCCCAAAAGACG
TTCATCTTTTCCGACTTTGAGTACGTTGGGGGCGCCTTTTATAAGAACATTGTCCGCTTCTCCAAGAGGGTCACG
TATAACACGGTCAAGGCCATCTTTGGCTTCGATGGCAGTTCCAACATTGGCAAGATTCACTTTGCCAGTATTCAG
GGCGCAACGTCGTTTGCGTCTTCCTTTCCGCATATTTTTGGCAGCGACGAGTCAAAAACGGCATCGATTCCCTGC
TTGATTCCCTGTGCCATTGACCAGGACCCGTACTTTCGCTTGACACGGGACTGTGCTGCAGGACTGCATTTGGCG
AAGCCGTCTTTGATCCATATGCGGTTTTTGGATGCTTTACAGGGCCCCGGCTCCAAAATGTCGGCCAGTGACGAC
ACATCGGCCATTTTCCTCACCGATTCGTCGAAGCAAATAAAGTCAAAAATTAATAAATACGCCTTTTCTGGCGGC
AGAGAAACACTAGAGGAACACAGAGAAAAGGGCGGCAATGCCGATGTGGATGTTGCCTACCAATACCTGCAGTTT
TTCCTGGAAAGCGATGAGCAACTAGCTCAAATAAAGGCCGACTACAATAGCGGCAAGCTTCTTACAGGCGAGATC
AAGGCAATTTGTATCGAATACCTCCAAAAATATGTCAGTGCGTTCCAGGACAGAAGACGCAAAGTTACAGACACA
GTCGTGGACGAGTTTATGAAGGCGCGGCCTCTAGAGTGGAAGGGTAATACCAAGGTGCCACGAGCCGACCTTGTT
GTCCCTGAAACGAGTGGCAATGCGGGAGCGGAAGGCGGCGCTGGCGAGAGCAAGCTGACCAAGAACCAAGTGAAG
AAGTTACTCAAGGAGCAGCAGGTTGCGCAGAAGAAGGCGGACAAGGCCAAGGAGAAGGCGGCCAGTGGCCAAGCA
GGCACTTGA
Gene >OphauG2|3836
ATGGCTTCTGCTACACACCCAGAGGCTGCAGCATCTCCTCGGGCAGCCTCGTCTAAACAGGACGTCAACCCGTGG
TCTGTATCGGGCGAAGTGGGCGACGACGGCAAGGTCAAGGCCATCGACTACCGCAAACTGGTGGAGGAATTTGGC
ACGACTCTGATTGACGATGCGCTGCTGGAACGCTTCGAGCGGGTGACGGGCCACAAGCCCCATCGCTTCATGCGC
CGACAAATTGTCTTTAGCCATCGTGATTTGTCCGTCATTCTCGATCGATATGAAAAGGTGCGAGGGCCGTCGCGC
AGGCCATGTCTGGAGAGATGGCTGATGGCCGGTAGAATGAGCCCTTTTTCCTCTATACTGGCCGTGGCCCGAGCA
GCGACAGCATGCATATTGGCCACACGCAAGTTTTTGACTTTGTCAAGTATGCCACCAGTTGAGCCGGCACACGAG
CCCTCAGTCTAGCTAACTCGTCTGCTTAGGTGGCTGCAAGACGTTTTGGATGTCCCATTGATCATCATGCTGACA
GATGGTGAGTCTGTGCCATGGTTGACTTGGCGGATGCACCACAATGGTGTAATGCTAACGACTAAAAGATGAAAA
ATTCCTCTTTTCTGAAAAGAGAAGCGTGCAAGAAGTCATGGGCTACACCCGTACAAATGCAATGGATATTATCGC
CATTGGCTTTGACCCCCAAAAGACGTTCATCTTTTCCGACTTTGAGTACGTTGGGGGCGCCTTTTATAAGAACAT
TGTCCGCTTCTCCAAGAGGGTCACGTATAACACGGTCAAGGCCATCTTTGGCTTCGATGGCAGTTCCAACATTGG
CAAGATTCACTTTGCCAGTATTCAGGGCGCAACGTCGTTTGCGTCTTCCTTTCCGCATATTTTTGGCAGCGACGA
GTCAAAAACGGCATCGATTCCCTGCTTGATTCCCTGTGCCATTGACCAGGACCCGTACTTTCGCTTGACACGGGA
CTGTGCTGCAGGACTGCATTTGGCGAAGCCGTCTTTGATCCATATGCGGTTTTTGGATGCTTTACAGGGCCCCGG
CTCCAAAATGTCGGCCAGTGACGACACATCGGCCATTTTCCTCACCGATTCGTCGAAGCAAATAAAGTCAAAAAT
TAATAAGTGCGTTTTTTTTTTTTTTGGCTTGACGGACAGTCATCGAAAGCCAAACTTGCCTGACACGAGTACACA
GATACGCCTTTTCTGGCGGCAGAGAAACACTAGAGGAACACAGAGAAAAGGGCGGCAATGCCGATGTGGATGTTG
CCTACCAATACCTGCAGTTTTTCCTGGAAAGCGATGAGGTATCTATCTATAGCCATGCACAATTTCTGGACAAAA
CAAACAACGTCTCGGGCTAACACGCACTGTAGCAACTAGCTCAAATAAAGGCCGACTACAATAGCGGCAAGCTTC
TTACAGGCGAGGTAAATATTCATGGGTGCGAGACAGAACAAGGTGTACTGACAAGTATATCAAAGATCAAGGCAA
TTTGTATCGAATACCTCCAAAAATATGTCAGTGCGTTCCAGGACAGAAGACGCAAAGTTACAGACACAGTCGTGG
ACGAGTTTATGAAGGCGCGGCCTCTAGAGTGGAAGGGTAATACCAAGGTGCCACGAGCCGACCTTGTTGTCCCTG
AAACGAGTGGCAATGCGGGAGCGGAAGGCGGCGCTGGCGAGAGCAAGCTGACCAAGAACCAAGTGAAGAAGTTAC
TCAAGGAGCAGCAGGTTGCGCAGAAGAAGGCGGACAAGGCCAAGGAGAAGGCGGCCAGTGGCCAAGCAGGCACTT
GA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail