Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|3833
Gene name
LocationContig_30:1676..2605
Strand+
Gene length (bp)929
Transcript length (bp)867
Coding sequence length (bp)867
Protein length (aa) 289

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01363 FYVE FYVE zinc finger 8.0E-15 161 231

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7M3|YNT3_SCHPO FYVE-type zinc finger-containing protein C9B6.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC9B6.03 PE=1 SV=1 158 288 7.0E-18
sp|Q54TC3|SLOB1_DICDI Probable inactive serine/threonine-protein kinase slob1 OS=Dictyostelium discoideum GN=slob1 PE=3 SV=1 158 237 6.0E-12
sp|O13786|PEP7_SCHPO Vacuolar segregation protein pep7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pep7 PE=3 SV=1 143 228 2.0E-10
sp|Q9BQS8|FYCO1_HUMAN FYVE and coiled-coil domain-containing protein 1 OS=Homo sapiens GN=FYCO1 PE=1 SV=3 148 282 4.0E-09
sp|Q69ZL1|FGD6_MOUSE FYVE, RhoGEF and PH domain-containing protein 6 OS=Mus musculus GN=Fgd6 PE=1 SV=2 162 260 2.0E-08
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7M3|YNT3_SCHPO FYVE-type zinc finger-containing protein C9B6.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC9B6.03 PE=1 SV=1 158 288 7.0E-18
sp|Q54TC3|SLOB1_DICDI Probable inactive serine/threonine-protein kinase slob1 OS=Dictyostelium discoideum GN=slob1 PE=3 SV=1 158 237 6.0E-12
sp|O13786|PEP7_SCHPO Vacuolar segregation protein pep7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pep7 PE=3 SV=1 143 228 2.0E-10
sp|Q9BQS8|FYCO1_HUMAN FYVE and coiled-coil domain-containing protein 1 OS=Homo sapiens GN=FYCO1 PE=1 SV=3 148 282 4.0E-09
sp|Q69ZL1|FGD6_MOUSE FYVE, RhoGEF and PH domain-containing protein 6 OS=Mus musculus GN=Fgd6 PE=1 SV=2 162 260 2.0E-08
sp|Q755J9|VPS27_ASHGO Vacuolar protein sorting-associated protein 27 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=VPS27 PE=3 SV=1 176 231 2.0E-08
sp|P53191|PIB2_YEAST Phosphatidylinositol 3-phosphate-binding protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PIB2 PE=1 SV=1 157 233 7.0E-08
sp|Q9Z1T6|FYV1_MOUSE 1-phosphatidylinositol 3-phosphate 5-kinase OS=Mus musculus GN=Pikfyve PE=1 SV=3 159 267 2.0E-07
sp|Q6ZV73|FGD6_HUMAN FYVE, RhoGEF and PH domain-containing protein 6 OS=Homo sapiens GN=FGD6 PE=1 SV=2 162 260 2.0E-07
sp|P40343|VPS27_YEAST Vacuolar protein sorting-associated protein 27 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VPS27 PE=1 SV=3 176 229 2.0E-07
sp|Q6ZPK7|LST2_MOUSE Lateral signaling target protein 2 homolog OS=Mus musculus GN=Zfyve28 PE=1 SV=2 161 227 2.0E-07
sp|Q6CL17|VPS27_KLULA Vacuolar protein sorting-associated protein 27 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=VPS27 PE=3 SV=1 175 229 2.0E-07
sp|Q9HCC9|LST2_HUMAN Lateral signaling target protein 2 homolog OS=Homo sapiens GN=ZFYVE28 PE=1 SV=3 161 227 3.0E-07
sp|Q8VDC1|FYCO1_MOUSE FYVE and coiled-coil domain-containing protein 1 OS=Mus musculus GN=Fyco1 PE=1 SV=1 165 282 3.0E-07
sp|Q0P4S0|LST2_XENTR Lateral signaling target protein 2 homolog OS=Xenopus tropicalis GN=zfyve28 PE=2 SV=1 162 227 3.0E-07
sp|Q0WUR5|FAB1A_ARATH 1-phosphatidylinositol-3-phosphate 5-kinase FAB1A OS=Arabidopsis thaliana GN=FAB1A PE=2 SV=1 158 281 3.0E-07
sp|Q9VB70|LST2_DROME Lateral signaling target protein 2 homolog OS=Drosophila melanogaster GN=CG6051 PE=1 SV=3 162 249 4.0E-07
sp|Q9Y2I7|FYV1_HUMAN 1-phosphatidylinositol 3-phosphate 5-kinase OS=Homo sapiens GN=PIKFYVE PE=1 SV=3 159 267 4.0E-07
sp|Q9ASS2|FREE1_ARATH Protein FREE1 OS=Arabidopsis thaliana GN=FREE1 PE=1 SV=1 71 230 5.0E-07
sp|B4IC49|LST2_DROSE Lateral signaling target protein 2 homolog OS=Drosophila sechellia GN=GM10129 PE=3 SV=1 162 249 5.0E-07
sp|B0G126|FYV1_DICDI 1-phosphatidylinositol 3-phosphate 5-kinase OS=Dictyostelium discoideum GN=pip5k3 PE=3 SV=1 152 232 8.0E-07
sp|A0JMD2|LST2_DANRE Lateral signaling target protein 2 homolog OS=Danio rerio GN=zfyve28 PE=2 SV=1 161 227 9.0E-07
sp|Q5ABD9|VPS27_CANAL Vacuolar protein sorting-associated protein 27 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=VPS27 PE=3 SV=1 136 247 1.0E-06
sp|B0WAQ0|LST2_CULQU Lateral signaling target protein 2 homolog OS=Culex quinquefasciatus GN=CPIJ004116 PE=3 SV=1 161 227 1.0E-06
sp|A8QCE4|LST2_BRUMA Lateral signaling target protein 2 homolog OS=Brugia malayi GN=Bm1_49520 PE=3 SV=1 148 227 2.0E-06
sp|Q9LUM0|FAB1B_ARATH 1-phosphatidylinositol-3-phosphate 5-kinase FAB1B OS=Arabidopsis thaliana GN=FAB1B PE=2 SV=1 158 229 2.0E-06
sp|B3P851|LST2_DROER Lateral signaling target protein 2 homolog OS=Drosophila erecta GN=GG12136 PE=3 SV=1 162 249 2.0E-06
sp|B4PRU6|LST2_DROYA Lateral signaling target protein 2 homolog OS=Drosophila yakuba GN=GE10583 PE=3 SV=1 162 249 2.0E-06
sp|Q3TB82|PKHF1_MOUSE Pleckstrin homology domain-containing family F member 1 OS=Mus musculus GN=Plekhf1 PE=2 SV=1 157 239 3.0E-06
sp|B4M140|LST2_DROVI Lateral signaling target protein 2 homolog OS=Drosophila virilis GN=GJ23073 PE=3 SV=1 162 241 4.0E-06
sp|Q91XS1|MTMR4_MOUSE Myotubularin-related protein 4 OS=Mus musculus GN=Mtmr4 PE=1 SV=1 162 237 5.0E-06
sp|A3LX75|VPS27_PICST Vacuolar protein sorting-associated protein 27 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=VPS27 PE=3 SV=2 162 232 5.0E-06
sp|Q9NYA4|MTMR4_HUMAN Myotubularin-related protein 4 OS=Homo sapiens GN=MTMR4 PE=1 SV=2 162 237 5.0E-06
sp|Q68FU1|PKHF1_RAT Pleckstrin homology domain-containing family F member 1 OS=Rattus norvegicus GN=Plekhf1 PE=2 SV=1 157 239 5.0E-06
sp|O96838|FYV1_DROME Putative 1-phosphatidylinositol 3-phosphate 5-kinase OS=Drosophila melanogaster GN=fab1 PE=1 SV=2 159 206 6.0E-06
sp|Q6BSD6|VPS27_DEBHA Vacuolar protein sorting-associated protein 27 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=VPS27 PE=3 SV=2 176 232 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0046872 metal ion binding Yes
GO:0003674 molecular_function No
GO:0043169 cation binding No
GO:0005488 binding No
GO:0043167 ion binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 32 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|3833
MAADLIMPTLPGDSQTSRHFLAQSRPPHSRAQSYNVPAGPQISPLSTSNTSASSQTASTPPSPKTYYMRQGRPMY
IPAVLRPCDEFPSWKMARCKTAGSSSDSDSDAGLRRVNSNLKTMVSLGVLSQRLGRRHAPDNMPVLHGDWDLDSF
PPPTSLPTRRHWKPDSESFVCDDATCKRSFSYFVRRHHCRKCGNIFCNWHSSFVLPLDQDAQFNPRAALSRACNH
CFQEIKAIYARDDAHSLQSVSSDANLATPSAPVAAPSATPNVSTCQAGDAAASVPRDWNWSTF*
Coding >OphauG2|3833
ATGGCAGCCGATCTCATCATGCCCACGCTGCCTGGCGACTCGCAAACCTCGCGCCACTTCTTGGCCCAGAGCCGC
CCGCCCCATAGCAGAGCCCAGTCGTACAATGTGCCCGCCGGCCCGCAAATCTCGCCTCTCAGCACCTCCAACACG
AGCGCCAGCAGCCAGACGGCGTCGACGCCGCCCTCCCCCAAGACGTACTACATGCGCCAGGGCCGCCCCATGTAC
ATTCCCGCCGTCCTGCGCCCGTGCGACGAGTTTCCCTCGTGGAAGATGGCGCGCTGCAAGACGGCCGGCTCGTCG
TCTGATTCCGACTCGGACGCTGGTTTGCGCCGCGTCAACTCCAATCTCAAGACCATGGTCAGTCTTGGTGTCCTG
AGCCAGCGCCTGGGCCGTCGCCATGCGCCCGACAACATGCCTGTGCTCCATGGCGACTGGGATCTCGACTCTTTC
CCCCCGCCTACATCTTTGCCCACTCGCAGGCACTGGAAGCCCGACTCCGAGTCCTTTGTCTGCGACGACGCCACC
TGCAAGCGCAGCTTTAGCTACTTTGTCCGCCGACACCACTGCCGCAAGTGTGGAAACATTTTTTGCAATTGGCAC
TCGAGCTTTGTTCTCCCTCTGGACCAGGACGCTCAGTTCAATCCTCGCGCCGCCCTCTCTCGCGCCTGCAACCAC
TGCTTCCAGGAGATCAAGGCCATTTACGCGCGCGACGACGCCCATTCCCTGCAATCTGTATCGTCAGACGCCAAT
CTCGCCACGCCTTCTGCGCCCGTTGCAGCCCCGTCGGCGACCCCGAATGTCTCGACATGCCAAGCGGGAGACGCA
GCTGCTAGTGTCCCGCGCGACTGGAATTGGAGCACATTTTGA
Transcript >OphauG2|3833
ATGGCAGCCGATCTCATCATGCCCACGCTGCCTGGCGACTCGCAAACCTCGCGCCACTTCTTGGCCCAGAGCCGC
CCGCCCCATAGCAGAGCCCAGTCGTACAATGTGCCCGCCGGCCCGCAAATCTCGCCTCTCAGCACCTCCAACACG
AGCGCCAGCAGCCAGACGGCGTCGACGCCGCCCTCCCCCAAGACGTACTACATGCGCCAGGGCCGCCCCATGTAC
ATTCCCGCCGTCCTGCGCCCGTGCGACGAGTTTCCCTCGTGGAAGATGGCGCGCTGCAAGACGGCCGGCTCGTCG
TCTGATTCCGACTCGGACGCTGGTTTGCGCCGCGTCAACTCCAATCTCAAGACCATGGTCAGTCTTGGTGTCCTG
AGCCAGCGCCTGGGCCGTCGCCATGCGCCCGACAACATGCCTGTGCTCCATGGCGACTGGGATCTCGACTCTTTC
CCCCCGCCTACATCTTTGCCCACTCGCAGGCACTGGAAGCCCGACTCCGAGTCCTTTGTCTGCGACGACGCCACC
TGCAAGCGCAGCTTTAGCTACTTTGTCCGCCGACACCACTGCCGCAAGTGTGGAAACATTTTTTGCAATTGGCAC
TCGAGCTTTGTTCTCCCTCTGGACCAGGACGCTCAGTTCAATCCTCGCGCCGCCCTCTCTCGCGCCTGCAACCAC
TGCTTCCAGGAGATCAAGGCCATTTACGCGCGCGACGACGCCCATTCCCTGCAATCTGTATCGTCAGACGCCAAT
CTCGCCACGCCTTCTGCGCCCGTTGCAGCCCCGTCGGCGACCCCGAATGTCTCGACATGCCAAGCGGGAGACGCA
GCTGCTAGTGTCCCGCGCGACTGGAATTGGAGCACATTTTGA
Gene >OphauG2|3833
ATGGCAGCCGATCTCATCATGCCCACGCTGCCTGGCGACTCGCAAACCTCGCGCCACTTCTTGGCCCAGAGCCGC
CCGCCCCATAGCAGAGCCCAGTCGTACAATGTGCCCGCCGGCCCGCAAATCTCGCCTCTCAGCACCTCCAACACG
AGCGCCAGCAGCCAGACGGCGTCGACGCCGCCCTCCCCCAAGACGTACTACATGCGCCAGGGCCGCCCCATGTAC
ATTCCCGCCGTCCTGCGCCCGTGCGACGAGTTTCCCTCGTGGAAGATGGCGCGCTGCAAGACGGCCGGCTCGTCG
TCTGATTCCGACTCGGACGCTGGTTTGCGCCGCGTCAACTCCAATCTCAAGACCATGGTCAGTCTTGGTGTCCTG
AGCCAGCGCCTGGGCCGTCGCCATGCGCCCGACAACATGCCTGTGCTCCATGGCGACTGGGATCTCGACTCTTTC
CCCCCGCCTACATCTTTGCCCACTCGCAGGCACTGGAAGGTAGGCTGGGCCCCCAACGCGTCGGTCGCATCGCCA
TCAATAGCTGACTCGGTCCCCATTAGCCCGACTCCGAGTCCTTTGTCTGCGACGACGCCACCTGCAAGCGCAGCT
TTAGCTACTTTGTCCGCCGACACCACTGCCGCAAGTGTGGAAACATTTTTTGCAATTGGCACTCGAGCTTTGTTC
TCCCTCTGGACCAGGACGCTCAGTTCAATCCTCGCGCCGCCCTCTCTCGCGCCTGCAACCACTGCTTCCAGGAGA
TCAAGGCCATTTACGCGCGCGACGACGCCCATTCCCTGCAATCTGTATCGTCAGACGCCAATCTCGCCACGCCTT
CTGCGCCCGTTGCAGCCCCGTCGGCGACCCCGAATGTCTCGACATGCCAAGCGGGAGACGCAGCTGCTAGTGTCC
CGCGCGACTGGAATTGGAGCACATTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail