Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|3830
Gene name
LocationContig_3:82614..85073
Strand-
Gene length (bp)2459
Transcript length (bp)2292
Coding sequence length (bp)2292
Protein length (aa) 764

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00218 IGPS Indole-3-glycerol phosphate synthase 6.6E-94 251 513
PF00117 GATase Glutamine amidotransferase class-I 2.7E-46 30 218
PF00697 PRAI N-(5'phosphoribosyl)anthranilate (PRA) isomerase 1.1E-43 603 757
PF07722 Peptidase_C26 Peptidase C26 1.3E-05 97 202

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P00908|TRPG_NEUCR Multifunctional tryptophan biosynthesis protein OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=trp-1 PE=3 SV=2 4 763 0.0E+00
sp|P24773|TRPG_PENCH Multifunctional tryptophan biosynthesis protein OS=Penicillium chrysogenum GN=trpC PE=3 SV=1 6 763 0.0E+00
sp|P06531|TRPG_EMENI Multifunctional tryptophan biosynthesis protein OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=trpC PE=2 SV=3 1 760 0.0E+00
sp|P05328|TRPG_ASPNG Multifunctional tryptophan biosynthesis protein OS=Aspergillus niger GN=trpC PE=3 SV=1 6 762 0.0E+00
sp|P18483|TRPG_ASPAW Multifunctional tryptophan biosynthesis protein OS=Aspergillus awamori GN=trpC PE=3 SV=1 6 762 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P00908|TRPG_NEUCR Multifunctional tryptophan biosynthesis protein OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=trp-1 PE=3 SV=2 4 763 0.0E+00
sp|P24773|TRPG_PENCH Multifunctional tryptophan biosynthesis protein OS=Penicillium chrysogenum GN=trpC PE=3 SV=1 6 763 0.0E+00
sp|P06531|TRPG_EMENI Multifunctional tryptophan biosynthesis protein OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=trpC PE=2 SV=3 1 760 0.0E+00
sp|P05328|TRPG_ASPNG Multifunctional tryptophan biosynthesis protein OS=Aspergillus niger GN=trpC PE=3 SV=1 6 762 0.0E+00
sp|P18483|TRPG_ASPAW Multifunctional tryptophan biosynthesis protein OS=Aspergillus awamori GN=trpC PE=3 SV=1 6 762 0.0E+00
sp|Q92411|TRPG_COCHE Multifunctional tryptophan biosynthesis protein OS=Cochliobolus heterostrophus GN=TRP1 PE=3 SV=1 5 762 0.0E+00
sp|Q92370|TRPG_SCHPO Multifunctional tryptophan biosynthesis protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=trp1 PE=2 SV=2 28 762 0.0E+00
sp|P20409|TRPG_PHYBL Multifunctional tryptophan biosynthesis protein OS=Phycomyces blakesleeanus GN=trp1 PE=3 SV=1 29 762 0.0E+00
sp|P0CN86|TRPG_CRYNJ Multifunctional tryptophan biosynthesis protein OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=TRP1 PE=3 SV=1 29 761 0.0E+00
sp|P0CN87|TRPG_CRYNB Multifunctional tryptophan biosynthesis protein OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=TRP1 PE=3 SV=1 29 761 0.0E+00
sp|P27710|TRPG_CRYNH Multifunctional tryptophan biosynthesis protein OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) GN=TRP1 PE=3 SV=2 29 761 0.0E+00
sp|P25170|TRPG_PHACH Multifunctional tryptophan biosynthesis protein OS=Phanerochaete chrysosporium GN=TRPC PE=3 SV=1 20 762 0.0E+00
sp|P00937|TRPG_YEAST Multifunctional tryptophan biosynthesis protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TRP3 PE=1 SV=2 23 514 0.0E+00
sp|P09575|TRPG_PICAN Multifunctional tryptophan biosynthesis protein (Fragment) OS=Pichia angusta PE=3 SV=1 22 401 4.0E-146
sp|P24920|TRPC_PHYPR Tryptophan biosynthesis protein TRP1 OS=Phytophthora parasitica GN=TRP1 PE=3 SV=1 249 760 7.0E-85
sp|P00901|TRPG_PSEPU Anthranilate synthase component 2 OS=Pseudomonas putida GN=trpG PE=1 SV=2 28 222 6.0E-61
sp|P20576|TRPG_PSEAE Anthranilate synthase component 2 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=trpG PE=3 SV=2 28 226 1.0E-60
sp|P06193|PABA_SALTY Aminodeoxychorismate synthase component 2 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=pabA PE=3 SV=1 28 217 3.0E-59
sp|P00903|PABA_ECOLI Aminodeoxychorismate synthase component 2 OS=Escherichia coli (strain K12) GN=pabA PE=1 SV=1 28 217 3.0E-58
sp|P06194|PABA_ENTAE Aminodeoxychorismate synthase component 2 OS=Enterobacter aerogenes GN=pabA PE=3 SV=1 28 217 1.0E-57
sp|P06195|PABA_SERMA Aminodeoxychorismate synthase component 2 OS=Serratia marcescens GN=pabA PE=3 SV=1 28 217 7.0E-57
sp|P00902|TRPG_ACIAD Anthranilate synthase component 2 OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=trpG PE=3 SV=1 28 217 1.0E-56
sp|Q08654|TRPGD_THEMA Bifunctional protein TrpGD OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=trpGD PE=3 SV=2 28 220 1.0E-53
sp|P28819|PABA_BACSU Aminodeoxychorismate/anthranilate synthase component 2 OS=Bacillus subtilis (strain 168) GN=pabA PE=2 SV=1 28 217 4.0E-53
sp|P48261|TRPG_CYAPA Anthranilate synthase component 2 OS=Cyanophora paradoxa GN=trpG PE=3 SV=1 28 217 5.0E-50
sp|A6X0L0|TRPC_OCHA4 Indole-3-glycerol phosphate synthase OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=trpC PE=3 SV=1 248 516 6.0E-49
sp|A7NMZ8|TRPC_ROSCS Indole-3-glycerol phosphate synthase OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=trpC PE=3 SV=1 248 513 7.0E-49
sp|B0CGT9|TRPC_BRUSI Indole-3-glycerol phosphate synthase OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=trpC PE=3 SV=1 248 518 1.0E-48
sp|A6Q3P0|TRPC_NITSB Indole-3-glycerol phosphate synthase OS=Nitratiruptor sp. (strain SB155-2) GN=trpC PE=3 SV=1 290 502 2.0E-48
sp|A5VQR5|TRPC_BRUO2 Indole-3-glycerol phosphate synthase OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=trpC PE=3 SV=1 248 518 2.0E-48
sp|A5USQ4|TRPC_ROSS1 Indole-3-glycerol phosphate synthase OS=Roseiflexus sp. (strain RS-1) GN=trpC PE=3 SV=1 248 517 2.0E-48
sp|P66989|TRPC_BRUSU Indole-3-glycerol phosphate synthase OS=Brucella suis biovar 1 (strain 1330) GN=trpC PE=3 SV=1 248 518 2.0E-48
sp|P66988|TRPC_BRUME Indole-3-glycerol phosphate synthase OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=trpC PE=3 SV=1 248 518 2.0E-48
sp|C0RJB1|TRPC_BRUMB Indole-3-glycerol phosphate synthase OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=trpC PE=3 SV=1 248 518 2.0E-48
sp|A9M5F4|TRPC_BRUC2 Indole-3-glycerol phosphate synthase OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=trpC PE=3 SV=1 248 518 2.0E-48
sp|Q57CZ8|TRPC_BRUAB Indole-3-glycerol phosphate synthase OS=Brucella abortus biovar 1 (strain 9-941) GN=trpC PE=3 SV=1 248 518 2.0E-48
sp|Q2YRR4|TRPC_BRUA2 Indole-3-glycerol phosphate synthase OS=Brucella abortus (strain 2308) GN=trpC PE=1 SV=1 248 518 2.0E-48
sp|B2S5Z1|TRPC_BRUA1 Indole-3-glycerol phosphate synthase OS=Brucella abortus (strain S19) GN=trpC PE=3 SV=1 248 518 2.0E-48
sp|P20441|TRPG_LEPBI Anthranilate synthase component 2 OS=Leptospira biflexa GN=trpG PE=3 SV=2 28 217 2.0E-48
sp|Q3Z6G5|TRPC_DEHM1 Indole-3-glycerol phosphate synthase OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=trpC PE=3 SV=1 287 513 5.0E-48
sp|Q3ZZ14|TRPC_DEHMC Indole-3-glycerol phosphate synthase OS=Dehalococcoides mccartyi (strain CBDB1) GN=trpC PE=3 SV=1 302 513 6.0E-48
sp|A5FPM3|TRPC_DEHMB Indole-3-glycerol phosphate synthase OS=Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1) GN=trpC PE=3 SV=1 302 513 3.0E-47
sp|A6WC91|TRPC_KINRD Indole-3-glycerol phosphate synthase OS=Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216) GN=trpC PE=3 SV=1 302 526 4.0E-47
sp|B2FKL1|TRPC_STRMK Indole-3-glycerol phosphate synthase OS=Stenotrophomonas maltophilia (strain K279a) GN=trpC PE=3 SV=1 248 502 7.0E-47
sp|Q98ME3|TRPC_RHILO Indole-3-glycerol phosphate synthase OS=Rhizobium loti (strain MAFF303099) GN=trpC PE=3 SV=1 248 516 1.0E-46
sp|B9JX64|TRPC_AGRVS Indole-3-glycerol phosphate synthase OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=trpC PE=3 SV=1 248 517 2.0E-46
sp|Q21SE8|TRPC_RHOFT Indole-3-glycerol phosphate synthase OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=trpC PE=3 SV=1 303 513 2.0E-46
sp|A9KL43|TRPC_CLOPH Indole-3-glycerol phosphate synthase OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=trpC PE=3 SV=1 302 515 3.0E-46
sp|B4SLE8|TRPC_STRM5 Indole-3-glycerol phosphate synthase OS=Stenotrophomonas maltophilia (strain R551-3) GN=trpC PE=3 SV=1 248 502 3.0E-46
sp|B4RBX5|TRPC_PHEZH Indole-3-glycerol phosphate synthase OS=Phenylobacterium zucineum (strain HLK1) GN=trpC PE=3 SV=1 248 507 5.0E-46
sp|Q2IWB0|TRPC_RHOP2 Indole-3-glycerol phosphate synthase OS=Rhodopseudomonas palustris (strain HaA2) GN=trpC PE=3 SV=1 248 505 6.0E-46
sp|B1GZC0|TRPC_UNCTG Indole-3-glycerol phosphate synthase OS=Uncultured termite group 1 bacterium phylotype Rs-D17 GN=trpC PE=3 SV=1 250 513 6.0E-46
sp|A8LGR8|TRPC_FRASN Indole-3-glycerol phosphate synthase OS=Frankia sp. (strain EAN1pec) GN=trpC PE=3 SV=1 302 521 7.0E-46
sp|A8ZZX0|TRPC_DESOH Indole-3-glycerol phosphate synthase OS=Desulfococcus oleovorans (strain DSM 6200 / Hxd3) GN=trpC PE=3 SV=1 250 515 1.0E-45
sp|A0AJ82|TRPC_LISW6 Indole-3-glycerol phosphate synthase OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=trpC PE=3 SV=1 249 502 1.0E-45
sp|Q9FJM5|ASB2_ARATH Anthranilate synthase beta subunit 2, chloroplastic OS=Arabidopsis thaliana GN=ASB2 PE=2 SV=1 28 217 3.0E-45
sp|C4Z138|TRPC_EUBE2 Indole-3-glycerol phosphate synthase OS=Eubacterium eligens (strain ATCC 27750 / VPI C15-48) GN=trpC PE=3 SV=1 294 513 3.0E-45
sp|A9VJW0|TRPC_BACWK Indole-3-glycerol phosphate synthase OS=Bacillus weihenstephanensis (strain KBAB4) GN=trpC PE=3 SV=1 304 512 3.0E-45
sp|Q11HU1|TRPC_CHESB Indole-3-glycerol phosphate synthase OS=Chelativorans sp. (strain BNC1) GN=trpC PE=3 SV=1 249 505 5.0E-45
sp|Q42565|ASB1_ARATH Anthranilate synthase beta subunit 1, chloroplastic OS=Arabidopsis thaliana GN=ASB1 PE=1 SV=1 28 217 5.0E-45
sp|A1VTG7|TRPC_POLNA Indole-3-glycerol phosphate synthase OS=Polaromonas naphthalenivorans (strain CJ2) GN=trpC PE=3 SV=1 303 513 6.0E-45
sp|A8I836|TRPC_AZOC5 Indole-3-glycerol phosphate synthase OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=trpC PE=3 SV=1 287 516 7.0E-45
sp|P33974|TRPG_HALVD Anthranilate synthase component 2 OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=trpG PE=3 SV=2 28 222 1.0E-44
sp|Q9HPG6|TRPG_HALSA Anthranilate synthase component 2 OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=trpG PE=3 SV=1 27 217 1.0E-44
sp|Q7XUS2|ASB1_ORYSJ Anthranilate synthase beta subunit 1, chloroplastic OS=Oryza sativa subsp. japonica GN=ASB1 PE=1 SV=1 28 217 2.0E-44
sp|A1VYK3|TRPC_CAMJJ Indole-3-glycerol phosphate synthase OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=trpC PE=3 SV=1 284 505 2.0E-44
sp|A7GYQ7|TRPC_CAMC5 Indole-3-glycerol phosphate synthase OS=Campylobacter curvus (strain 525.92) GN=trpC PE=3 SV=1 304 516 2.0E-44
sp|P05379|TRPG_THET8 Anthranilate synthase component 2 OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=trpG PE=3 SV=1 28 217 2.0E-44
sp|A7H4P0|TRPC_CAMJD Indole-3-glycerol phosphate synthase OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=trpC PE=3 SV=1 284 505 2.0E-44
sp|Q5HVR3|TRPC_CAMJR Indole-3-glycerol phosphate synthase OS=Campylobacter jejuni (strain RM1221) GN=trpC PE=3 SV=1 284 505 2.0E-44
sp|Q9PI11|TRPC_CAMJE Indole-3-glycerol phosphate synthase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=trpC PE=3 SV=1 284 505 2.0E-44
sp|A8FKS2|TRPC_CAMJ8 Indole-3-glycerol phosphate synthase OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=trpC PE=3 SV=1 284 505 2.0E-44
sp|Q0SHZ5|TRPC_RHOJR Indole-3-glycerol phosphate synthase OS=Rhodococcus jostii (strain RHA1) GN=trpC PE=3 SV=1 302 527 2.0E-44
sp|B9LAF4|TRPC_NAUPA Indole-3-glycerol phosphate synthase OS=Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH) GN=trpC PE=3 SV=1 304 502 2.0E-44
sp|Q5V214|TRPG1_HALMA Anthranilate synthase component II OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=trpG1 PE=3 SV=1 12 217 2.0E-44
sp|B8I0V0|TRPC_CLOCE Indole-3-glycerol phosphate synthase OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=trpC PE=3 SV=1 295 513 3.0E-44
sp|C1AT55|TRPC_RHOOB Indole-3-glycerol phosphate synthase OS=Rhodococcus opacus (strain B4) GN=trpC PE=3 SV=1 302 527 3.0E-44
sp|Q1XDC5|TRPG_PYRYE Anthranilate synthase component 2 OS=Pyropia yezoensis GN=trpG PE=3 SV=1 28 217 3.0E-44
sp|Q71Z38|TRPC_LISMF Indole-3-glycerol phosphate synthase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=trpC PE=3 SV=1 291 507 4.0E-44
sp|C1KVS7|TRPC_LISMC Indole-3-glycerol phosphate synthase OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=trpC PE=3 SV=1 291 507 4.0E-44
sp|B8DHB2|TRPC_LISMH Indole-3-glycerol phosphate synthase OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=trpC PE=3 SV=1 291 507 4.0E-44
sp|B0K8T4|TRPC_THEP3 Indole-3-glycerol phosphate synthase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=trpC PE=3 SV=1 302 501 4.0E-44
sp|B0K2U1|TRPC_THEPX Indole-3-glycerol phosphate synthase OS=Thermoanaerobacter sp. (strain X514) GN=trpC PE=3 SV=1 302 501 7.0E-44
sp|Q764B9|ASB2_ORYSJ Anthranilate synthase beta subunit 2, chloroplastic OS=Oryza sativa subsp. japonica GN=ASB2 PE=2 SV=1 28 227 7.0E-44
sp|B1YLS2|TRPC_EXIS2 Indole-3-glycerol phosphate synthase OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=trpC PE=3 SV=1 301 518 7.0E-44
sp|B8EJS1|TRPC_METSB Indole-3-glycerol phosphate synthase OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=trpC PE=3 SV=1 248 520 8.0E-44
sp|Q7UKJ7|TRPC_RHOBA Indole-3-glycerol phosphate synthase OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=trpC PE=3 SV=1 302 508 1.0E-43
sp|C3MCF2|TRPC_RHISN Indole-3-glycerol phosphate synthase OS=Rhizobium sp. (strain NGR234) GN=trpC PE=3 SV=1 248 517 2.0E-43
sp|A8ET36|TRPC_ARCB4 Indole-3-glycerol phosphate synthase OS=Arcobacter butzleri (strain RM4018) GN=trpC PE=3 SV=1 291 504 2.0E-43
sp|A0PP28|TRPC_MYCUA Indole-3-glycerol phosphate synthase OS=Mycobacterium ulcerans (strain Agy99) GN=trpC PE=3 SV=1 302 527 2.0E-43
sp|B7JES8|TRPC_BACC0 Indole-3-glycerol phosphate synthase OS=Bacillus cereus (strain AH820) GN=trpC PE=3 SV=1 304 512 3.0E-43
sp|Q81TM0|TRPC_BACAN Indole-3-glycerol phosphate synthase OS=Bacillus anthracis GN=trpC PE=3 SV=1 304 512 3.0E-43
sp|C3LAW0|TRPC_BACAC Indole-3-glycerol phosphate synthase OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=trpC PE=3 SV=1 304 512 3.0E-43
sp|C3P3T8|TRPC_BACAA Indole-3-glycerol phosphate synthase OS=Bacillus anthracis (strain A0248) GN=trpC PE=3 SV=1 304 512 3.0E-43
sp|Q6HLU6|TRPC_BACHK Indole-3-glycerol phosphate synthase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=trpC PE=3 SV=1 304 512 3.0E-43
sp|Q30SM1|TRPC_SULDN Indole-3-glycerol phosphate synthase OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=trpC PE=3 SV=1 291 517 3.0E-43
sp|B9JFD8|TRPC_AGRRK Indole-3-glycerol phosphate synthase OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=trpC PE=3 SV=1 248 516 3.0E-43
sp|O68814|TRPC1_STRCO Indole-3-glycerol phosphate synthase 1 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=trpC1 PE=3 SV=3 302 521 4.0E-43
sp|A1BDW1|TRPC_CHLPD Indole-3-glycerol phosphate synthase OS=Chlorobium phaeobacteroides (strain DSM 266) GN=trpC PE=3 SV=1 258 505 5.0E-43
sp|Q8Y6Q4|TRPC_LISMO Indole-3-glycerol phosphate synthase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=trpC PE=3 SV=1 249 502 6.0E-43
sp|B2JHI8|TRPC_BURP8 Indole-3-glycerol phosphate synthase OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=trpC PE=3 SV=1 303 513 6.0E-43
sp|Q9A727|TRPC_CAUCR Indole-3-glycerol phosphate synthase OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=trpC PE=3 SV=1 248 507 8.0E-43
sp|B8GWP9|TRPC_CAUCN Indole-3-glycerol phosphate synthase OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=trpC PE=3 SV=1 248 507 8.0E-43
sp|Q63EC9|TRPC_BACCZ Indole-3-glycerol phosphate synthase OS=Bacillus cereus (strain ZK / E33L) GN=trpC PE=3 SV=1 304 512 9.0E-43
sp|B0U1P0|TRPC_XYLFM Indole-3-glycerol phosphate synthase OS=Xylella fastidiosa (strain M12) GN=trpC PE=3 SV=1 301 505 9.0E-43
sp|B2IKL7|TRPC_BEII9 Indole-3-glycerol phosphate synthase OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=trpC PE=3 SV=1 249 507 9.0E-43
sp|Q87EX2|TRPC_XYLFT Indole-3-glycerol phosphate synthase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=trpC PE=3 SV=1 301 505 1.0E-42
sp|B2I6S5|TRPC_XYLF2 Indole-3-glycerol phosphate synthase OS=Xylella fastidiosa (strain M23) GN=trpC PE=3 SV=1 301 505 1.0E-42
sp|P51362|TRPG_PORPU Anthranilate synthase component 2 OS=Porphyra purpurea GN=trpG PE=3 SV=1 28 217 1.0E-42
sp|C1ELE8|TRPC_BACC3 Indole-3-glycerol phosphate synthase OS=Bacillus cereus (strain 03BB102) GN=trpC PE=3 SV=1 304 512 1.0E-42
sp|A0RB62|TRPC_BACAH Indole-3-glycerol phosphate synthase OS=Bacillus thuringiensis (strain Al Hakam) GN=trpC PE=3 SV=1 304 512 1.0E-42
sp|A4G1P4|TRPC_HERAR Indole-3-glycerol phosphate synthase OS=Herminiimonas arsenicoxydans GN=trpC PE=3 SV=1 248 515 1.0E-42
sp|A0RNN3|TRPC_CAMFF Indole-3-glycerol phosphate synthase OS=Campylobacter fetus subsp. fetus (strain 82-40) GN=trpC PE=3 SV=1 264 502 1.0E-42
sp|B2HQX7|TRPC_MYCMM Indole-3-glycerol phosphate synthase OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=trpC PE=3 SV=1 302 527 1.0E-42
sp|Q9PGT5|TRPC_XYLFA Indole-3-glycerol phosphate synthase OS=Xylella fastidiosa (strain 9a5c) GN=trpC PE=3 SV=1 301 505 1.0E-42
sp|P94327|TRPC_BRADU Indole-3-glycerol phosphate synthase OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=trpC PE=3 SV=2 248 507 1.0E-42
sp|Q92B79|TRPC_LISIN Indole-3-glycerol phosphate synthase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=trpC PE=3 SV=1 291 502 1.0E-42
sp|Q97EF3|TRPC_CLOAB Indole-3-glycerol phosphate synthase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=trpC PE=3 SV=1 301 518 1.0E-42
sp|Q81GG7|TRPC_BACCR Indole-3-glycerol phosphate synthase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=trpC PE=3 SV=1 304 512 2.0E-42
sp|Q2K879|TRPC_RHIEC Indole-3-glycerol phosphate synthase OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=trpC PE=3 SV=1 248 516 2.0E-42
sp|C1D7J7|TRPC_LARHH Indole-3-glycerol phosphate synthase OS=Laribacter hongkongensis (strain HLHK9) GN=trpC PE=3 SV=1 297 513 2.0E-42
sp|Q123F4|TRPC_POLSJ Indole-3-glycerol phosphate synthase OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=trpC PE=3 SV=1 303 513 2.0E-42
sp|B7IM74|TRPC_BACC2 Indole-3-glycerol phosphate synthase OS=Bacillus cereus (strain G9842) GN=trpC PE=3 SV=1 304 512 2.0E-42
sp|Q92PR9|TRPC_RHIME Indole-3-glycerol phosphate synthase OS=Rhizobium meliloti (strain 1021) GN=trpC PE=3 SV=1 248 517 2.0E-42
sp|Q136D2|TRPC_RHOPS Indole-3-glycerol phosphate synthase OS=Rhodopseudomonas palustris (strain BisB5) GN=trpC PE=3 SV=1 291 507 3.0E-42
sp|B9IU36|TRPC_BACCQ Indole-3-glycerol phosphate synthase OS=Bacillus cereus (strain Q1) GN=trpC PE=3 SV=1 304 512 3.0E-42
sp|B7I0F0|TRPC_BACC7 Indole-3-glycerol phosphate synthase OS=Bacillus cereus (strain AH187) GN=trpC PE=3 SV=1 304 512 3.0E-42
sp|B7HGZ9|TRPC_BACC4 Indole-3-glycerol phosphate synthase OS=Bacillus cereus (strain B4264) GN=trpC PE=3 SV=1 304 512 3.0E-42
sp|Q03CY1|TRPC_LACC3 Indole-3-glycerol phosphate synthase OS=Lactobacillus casei (strain ATCC 334) GN=trpC PE=3 SV=1 291 503 3.0E-42
sp|B3W6W8|TRPC_LACCB Indole-3-glycerol phosphate synthase OS=Lactobacillus casei (strain BL23) GN=trpC PE=3 SV=1 291 503 3.0E-42
sp|B3Q6M9|TRPC_RHOPT Indole-3-glycerol phosphate synthase OS=Rhodopseudomonas palustris (strain TIE-1) GN=trpC PE=3 SV=1 248 505 5.0E-42
sp|Q6AF68|TRPC_LEIXX Indole-3-glycerol phosphate synthase OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=trpC PE=3 SV=1 298 501 5.0E-42
sp|Q44603|TRPC_BUCSC Tryptophan biosynthesis protein TrpCF OS=Buchnera aphidicola subsp. Schlechtendalia chinensis GN=trpC PE=3 SV=1 303 743 5.0E-42
sp|A8Z6K1|TRPC_CAMC1 Indole-3-glycerol phosphate synthase OS=Campylobacter concisus (strain 13826) GN=trpC PE=3 SV=1 284 517 5.0E-42
sp|Q7TTU3|TRPC_SYNPX Indole-3-glycerol phosphate synthase OS=Synechococcus sp. (strain WH8102) GN=trpC PE=3 SV=1 248 516 8.0E-42
sp|Q0K6I0|TRPC_CUPNH Indole-3-glycerol phosphate synthase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=trpC PE=3 SV=1 248 513 9.0E-42
sp|Q6AMS4|TRPC_DESPS Indole-3-glycerol phosphate synthase OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=trpC PE=3 SV=1 302 513 1.0E-41
sp|Q3ABS1|TRPC_CARHZ Indole-3-glycerol phosphate synthase OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=trpC PE=3 SV=1 252 505 1.0E-41
sp|B3Q0L3|TRPC_RHIE6 Indole-3-glycerol phosphate synthase OS=Rhizobium etli (strain CIAT 652) GN=trpC PE=3 SV=1 248 516 1.0E-41
sp|A1T8X3|TRPC_MYCVP Indole-3-glycerol phosphate synthase OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=trpC PE=3 SV=1 285 527 1.0E-41
sp|Q88WI2|TRPC_LACPL Indole-3-glycerol phosphate synthase OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=trpC PE=3 SV=1 264 518 1.0E-41
sp|B3EG28|TRPC_CHLL2 Indole-3-glycerol phosphate synthase OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=trpC PE=3 SV=1 258 505 1.0E-41
sp|A0QX95|TRPC_MYCS2 Indole-3-glycerol phosphate synthase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=trpC PE=1 SV=1 249 527 1.0E-41
sp|A3DDS7|TRPC_CLOTH Indole-3-glycerol phosphate synthase OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=trpC PE=3 SV=1 301 513 2.0E-41
sp|Q215B9|TRPC_RHOPB Indole-3-glycerol phosphate synthase OS=Rhodopseudomonas palustris (strain BisB18) GN=trpC PE=3 SV=1 291 507 2.0E-41
sp|Q03X00|TRPC_LEUMM Indole-3-glycerol phosphate synthase OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=trpC PE=3 SV=1 271 513 2.0E-41
sp|Q9KST5|TRPC_VIBCH Tryptophan biosynthesis protein TrpCF OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=trpCF PE=3 SV=1 284 752 2.0E-41
sp|A4SV52|TRPC_POLSQ Indole-3-glycerol phosphate synthase OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=trpC PE=3 SV=1 304 513 2.0E-41
sp|Q7CYR2|TRPC_AGRFC Indole-3-glycerol phosphate synthase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=trpC PE=3 SV=2 248 516 2.0E-41
sp|Q1B7H6|TRPC_MYCSS Indole-3-glycerol phosphate synthase OS=Mycobacterium sp. (strain MCS) GN=trpC PE=3 SV=1 284 527 2.0E-41
sp|A1UHJ6|TRPC_MYCSK Indole-3-glycerol phosphate synthase OS=Mycobacterium sp. (strain KMS) GN=trpC PE=3 SV=1 284 527 2.0E-41
sp|A3Q119|TRPC_MYCSJ Indole-3-glycerol phosphate synthase OS=Mycobacterium sp. (strain JLS) GN=trpC PE=3 SV=1 284 527 2.0E-41
sp|Q82A84|TRPC_STRAW Indole-3-glycerol phosphate synthase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=trpC PE=3 SV=1 302 521 2.0E-41
sp|B5ERI2|TRPC_ACIF5 Indole-3-glycerol phosphate synthase OS=Acidithiobacillus ferrooxidans (strain ATCC 53993) GN=trpC PE=3 SV=1 248 502 2.0E-41
sp|B7JBC0|TRPC_ACIF2 Indole-3-glycerol phosphate synthase OS=Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455) GN=trpC PE=3 SV=1 248 502 2.0E-41
sp|Q5P2G1|TRPC_AROAE Indole-3-glycerol phosphate synthase OS=Aromatoleum aromaticum (strain EbN1) GN=trpC PE=3 SV=1 294 505 2.0E-41
sp|B5ZPY7|TRPC_RHILW Indole-3-glycerol phosphate synthase OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=trpC PE=3 SV=1 301 516 2.0E-41
sp|P17217|TRPC_LACCA Indole-3-glycerol phosphate synthase OS=Lactobacillus casei GN=trpC PE=3 SV=1 291 511 2.0E-41
sp|Q2G6R0|TRPC_NOVAD Indole-3-glycerol phosphate synthase OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=trpC PE=3 SV=1 303 505 3.0E-41
sp|Q3AU73|TRPC_CHLCH Indole-3-glycerol phosphate synthase OS=Chlorobium chlorochromatii (strain CaD3) GN=trpC PE=3 SV=1 251 500 3.0E-41
sp|Q8PD70|TRPC_XANCP Indole-3-glycerol phosphate synthase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=trpC PE=3 SV=1 303 505 3.0E-41
sp|Q4UZF8|TRPC_XANC8 Indole-3-glycerol phosphate synthase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=trpC PE=3 SV=1 303 505 3.0E-41
sp|Q1MGE1|TRPC_RHIL3 Indole-3-glycerol phosphate synthase OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=trpC PE=3 SV=1 248 516 3.0E-41
sp|A9HY11|TRPC_BORPD Indole-3-glycerol phosphate synthase OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=trpC PE=3 SV=1 248 513 3.0E-41
sp|Q740P4|TRPC_MYCPA Indole-3-glycerol phosphate synthase OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=trpC PE=3 SV=1 302 527 4.0E-41
sp|A0QHH0|TRPC_MYCA1 Indole-3-glycerol phosphate synthase OS=Mycobacterium avium (strain 104) GN=trpC PE=3 SV=1 302 527 4.0E-41
sp|A6U9C5|TRPC_SINMW Indole-3-glycerol phosphate synthase OS=Sinorhizobium medicae (strain WSM419) GN=trpC PE=3 SV=1 248 517 4.0E-41
sp|B1XSZ1|TRPC_POLNS Indole-3-glycerol phosphate synthase OS=Polynucleobacter necessarius subsp. necessarius (strain STIR1) GN=trpC PE=3 SV=1 248 515 4.0E-41
sp|Q9KCB2|TRPC_BACHD Indole-3-glycerol phosphate synthase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=trpC PE=3 SV=1 289 516 4.0E-41
sp|P00910|TRPC_SALTY Tryptophan biosynthesis protein TrpCF OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=trpC PE=3 SV=1 302 742 5.0E-41
sp|B1ZW79|TRPC_OPITP Indole-3-glycerol phosphate synthase OS=Opitutus terrae (strain DSM 11246 / PB90-1) GN=trpC PE=3 SV=1 281 513 5.0E-41
sp|B1WQE4|TRPC_CYAA5 Indole-3-glycerol phosphate synthase OS=Cyanothece sp. (strain ATCC 51142) GN=trpC PE=3 SV=1 246 515 5.0E-41
sp|B2SL03|TRPC_XANOP Indole-3-glycerol phosphate synthase OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=trpC PE=3 SV=1 301 505 5.0E-41
sp|A4SG41|TRPC_CHLPM Indole-3-glycerol phosphate synthase OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=trpC PE=3 SV=1 258 521 6.0E-41
sp|P22098|TRPC_VIBPA Tryptophan biosynthesis protein TrpCF OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=trpC PE=3 SV=2 271 760 8.0E-41
sp|Q9X7C7|TRPC_MYCLE Indole-3-glycerol phosphate synthase OS=Mycobacterium leprae (strain TN) GN=trpC PE=3 SV=1 302 527 8.0E-41
sp|B8ZRB9|TRPC_MYCLB Indole-3-glycerol phosphate synthase OS=Mycobacterium leprae (strain Br4923) GN=trpC PE=3 SV=1 302 527 8.0E-41
sp|A5EK25|TRPC_BRASB Indole-3-glycerol phosphate synthase OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=trpC PE=3 SV=1 248 523 9.0E-41
sp|Q7M831|TRPC_WOLSU Indole-3-glycerol phosphate synthase OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=trpC PE=3 SV=1 304 507 1.0E-40
sp|Q2NYD7|TRPC_XANOM Indole-3-glycerol phosphate synthase OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=trpC PE=3 SV=1 301 505 1.0E-40
sp|B4SDV8|TRPC_PELPB Indole-3-glycerol phosphate synthase OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=trpC PE=3 SV=1 269 505 1.0E-40
sp|Q3SRJ3|TRPC_NITWN Indole-3-glycerol phosphate synthase OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=trpC PE=3 SV=1 301 507 1.0E-40
sp|B0JTM2|TRPC_MICAN Indole-3-glycerol phosphate synthase OS=Microcystis aeruginosa (strain NIES-843) GN=trpC PE=3 SV=1 248 513 1.0E-40
sp|A5N7N8|TRPC_CLOK5 Indole-3-glycerol phosphate synthase OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=trpC PE=3 SV=1 301 502 2.0E-40
sp|B9E149|TRPC_CLOK1 Indole-3-glycerol phosphate synthase OS=Clostridium kluyveri (strain NBRC 12016) GN=trpC PE=3 SV=1 301 502 2.0E-40
sp|B1W0N8|TRPC_STRGG Indole-3-glycerol phosphate synthase OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=trpC PE=3 SV=1 302 521 2.0E-40
sp|B2UDK9|TRPC_RALPJ Indole-3-glycerol phosphate synthase OS=Ralstonia pickettii (strain 12J) GN=trpC PE=3 SV=1 265 513 2.0E-40
sp|Q3BYB5|TRPC_XANC5 Indole-3-glycerol phosphate synthase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=trpC PE=3 SV=1 301 505 2.0E-40
sp|Q07NF6|TRPC_RHOP5 Indole-3-glycerol phosphate synthase OS=Rhodopseudomonas palustris (strain BisA53) GN=trpC PE=3 SV=1 248 507 2.0E-40
sp|Q8PQ47|TRPC_XANAC Indole-3-glycerol phosphate synthase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=trpC PE=3 SV=1 301 505 3.0E-40
sp|Q55508|TRPC_SYNY3 Indole-3-glycerol phosphate synthase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=trpC PE=3 SV=1 248 513 3.0E-40
sp|Q5ZX99|TRPC_LEGPH Indole-3-glycerol phosphate synthase OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=trpC PE=3 SV=1 248 505 3.0E-40
sp|Q5X6S0|TRPC_LEGPA Indole-3-glycerol phosphate synthase OS=Legionella pneumophila (strain Paris) GN=trpC PE=3 SV=1 248 505 3.0E-40
sp|B3R703|TRPC_CUPTR Indole-3-glycerol phosphate synthase OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=trpC PE=3 SV=1 248 513 3.0E-40
sp|A5IG82|TRPC_LEGPC Indole-3-glycerol phosphate synthase OS=Legionella pneumophila (strain Corby) GN=trpC PE=3 SV=1 248 505 4.0E-40
sp|Q7VU67|TRPC_BORPE Indole-3-glycerol phosphate synthase OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=trpC PE=3 SV=1 248 515 4.0E-40
sp|B0SYZ4|TRPC_CAUSK Indole-3-glycerol phosphate synthase OS=Caulobacter sp. (strain K31) GN=trpC PE=3 SV=1 297 505 4.0E-40
sp|B6JG29|TRPC_OLICO Indole-3-glycerol phosphate synthase OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=trpC PE=3 SV=1 248 507 4.0E-40
sp|A7HXZ6|TRPC_PARL1 Indole-3-glycerol phosphate synthase OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=trpC PE=3 SV=1 248 521 4.0E-40
sp|Q8ESU2|TRPC_OCEIH Indole-3-glycerol phosphate synthase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=trpC PE=3 SV=1 287 503 5.0E-40
sp|Q7W387|TRPC_BORPA Indole-3-glycerol phosphate synthase OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=trpC PE=3 SV=1 248 515 5.0E-40
sp|Q7WEK6|TRPC_BORBR Indole-3-glycerol phosphate synthase OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=trpC PE=3 SV=1 248 515 5.0E-40
sp|B1MBV4|TRPC_MYCA9 Indole-3-glycerol phosphate synthase OS=Mycobacterium abscessus (strain ATCC 19977 / DSM 44196 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543) GN=trpC PE=3 SV=1 302 527 5.0E-40
sp|P26922|TRPG_AZOBR Anthranilate synthase component 2 OS=Azospirillum brasilense GN=trpG PE=1 SV=1 28 217 6.0E-40
sp|B3QZD6|TRPC_CHLT3 Indole-3-glycerol phosphate synthase OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) GN=trpC PE=3 SV=1 296 501 7.0E-40
sp|A1SL44|TRPC_NOCSJ Indole-3-glycerol phosphate synthase OS=Nocardioides sp. (strain BAA-499 / JS614) GN=trpC PE=3 SV=1 303 505 8.0E-40
sp|Q8Z7D9|TRPC_SALTI Tryptophan biosynthesis protein TrpCF OS=Salmonella typhi GN=trpC PE=3 SV=1 302 742 8.0E-40
sp|Q5WGS3|TRPC_BACSK Indole-3-glycerol phosphate synthase OS=Bacillus clausii (strain KSM-K16) GN=trpC PE=3 SV=1 295 517 9.0E-40
sp|A6SUH5|TRPC_JANMA Indole-3-glycerol phosphate synthase OS=Janthinobacterium sp. (strain Marseille) GN=trpC PE=3 SV=1 304 513 1.0E-39
sp|Q8KBW1|TRPC_CHLTE Indole-3-glycerol phosphate synthase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=trpC PE=3 SV=1 286 509 1.0E-39
sp|Q1QMJ9|TRPC_NITHX Indole-3-glycerol phosphate synthase OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=trpC PE=3 SV=1 249 525 1.0E-39
sp|P9WFX7|TRPC_MYCTU Indole-3-glycerol phosphate synthase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=trpC PE=1 SV=1 302 527 1.0E-39
sp|A5U2W7|TRPC_MYCTA Indole-3-glycerol phosphate synthase OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=trpC PE=3 SV=1 302 527 1.0E-39
sp|C1ANN3|TRPC_MYCBT Indole-3-glycerol phosphate synthase OS=Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) GN=trpC PE=3 SV=1 302 527 1.0E-39
sp|A1KJ27|TRPC_MYCBP Indole-3-glycerol phosphate synthase OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=trpC PE=3 SV=1 302 527 1.0E-39
sp|P0A633|TRPC_MYCBO Indole-3-glycerol phosphate synthase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=trpC PE=3 SV=1 302 527 1.0E-39
sp|O67657|TRPC_AQUAE Indole-3-glycerol phosphate synthase OS=Aquifex aeolicus (strain VF5) GN=trpC PE=3 SV=1 304 514 2.0E-39
sp|Q8X7B7|TRPC_ECO57 Tryptophan biosynthesis protein TrpCF OS=Escherichia coli O157:H7 GN=trpC PE=3 SV=3 303 742 2.0E-39
sp|Q8ZEG8|TRPC_YERPE Tryptophan biosynthesis protein TrpCF OS=Yersinia pestis GN=trpC PE=3 SV=1 287 760 2.0E-39
sp|A0JVL1|TRPC_ARTS2 Indole-3-glycerol phosphate synthase OS=Arthrobacter sp. (strain FB24) GN=trpC PE=3 SV=1 304 501 2.0E-39
sp|A4FLL0|TRPC_SACEN Indole-3-glycerol phosphate synthase OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=trpC PE=3 SV=1 302 527 2.0E-39
sp|B3QLY7|TRPC_CHLP8 Indole-3-glycerol phosphate synthase OS=Chlorobaculum parvum (strain NCIB 8327) GN=trpC PE=3 SV=1 302 509 3.0E-39
sp|Q8XS01|TRPC2_RALSO Indole-3-glycerol phosphate synthase 2 OS=Ralstonia solanacearum (strain GMI1000) GN=trpC2 PE=3 SV=1 286 503 3.0E-39
sp|P9WFX6|TRPC_MYCTO Indole-3-glycerol phosphate synthase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=trpC PE=3 SV=1 302 527 3.0E-39
sp|Q9ZFA7|TRPC_RHOS4 Indole-3-glycerol phosphate synthase OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=trpC PE=3 SV=1 304 505 4.0E-39
sp|A1R5S7|TRPC_ARTAT Indole-3-glycerol phosphate synthase OS=Arthrobacter aurescens (strain TC1) GN=trpC PE=3 SV=1 301 501 4.0E-39
sp|Q9JSN4|TRPC_NEIMA Indole-3-glycerol phosphate synthase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=trpC PE=3 SV=1 248 513 4.0E-39
sp|Q5WY75|TRPC_LEGPL Indole-3-glycerol phosphate synthase OS=Legionella pneumophila (strain Lens) GN=trpC PE=3 SV=1 248 505 5.0E-39
sp|Q9K192|TRPC_NEIMB Indole-3-glycerol phosphate synthase OS=Neisseria meningitidis serogroup B (strain MC58) GN=trpC PE=3 SV=1 248 513 5.0E-39
sp|A4T9N5|TRPC_MYCGI Indole-3-glycerol phosphate synthase OS=Mycobacterium gilvum (strain PYR-GCK) GN=trpC PE=3 SV=1 302 527 5.0E-39
sp|B7K0H0|TRPC_CYAP8 Indole-3-glycerol phosphate synthase OS=Cyanothece sp. (strain PCC 8801) GN=trpC PE=3 SV=1 230 513 6.0E-39
sp|Q9XBM3|TRPC_ZYMMT Indole-3-glycerol phosphate synthase OS=Zymomonas mobilis subsp. pomaceae (strain ATCC 29192 / JCM 10191 / NBRC 13757 / NCIMB 11200 / NRRL B-4491) GN=trpC PE=3 SV=2 303 505 6.0E-39
sp|C5BV85|TRPC_BEUC1 Indole-3-glycerol phosphate synthase OS=Beutenbergia cavernae (strain ATCC BAA-8 / DSM 12333 / NBRC 16432) GN=trpC PE=3 SV=1 302 521 7.0E-39
sp|Q5NQ36|TRPC_ZYMMO Indole-3-glycerol phosphate synthase OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=trpC PE=3 SV=1 248 505 8.0E-39
sp|Q3SGS2|TRPC_THIDA Indole-3-glycerol phosphate synthase OS=Thiobacillus denitrificans (strain ATCC 25259) GN=trpC PE=3 SV=1 303 505 8.0E-39
sp|Q10ZM7|TRPC_TRIEI Indole-3-glycerol phosphate synthase OS=Trichodesmium erythraeum (strain IMS101) GN=trpC PE=3 SV=1 244 518 8.0E-39
sp|Q7NUI6|TRPC_CHRVO Indole-3-glycerol phosphate synthase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=trpC PE=3 SV=1 291 513 9.0E-39
sp|P00909|TRPC_ECOLI Tryptophan biosynthesis protein TrpCF OS=Escherichia coli (strain K12) GN=trpC PE=1 SV=4 303 742 9.0E-39
sp|A4WX67|TRPC_RHOS5 Indole-3-glycerol phosphate synthase OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=trpC PE=3 SV=1 304 505 1.0E-38
sp|Q5F645|TRPC_NEIG1 Indole-3-glycerol phosphate synthase OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=trpC PE=3 SV=1 248 513 1.0E-38
sp|Q8XVE6|TRPC1_RALSO Indole-3-glycerol phosphate synthase 1 OS=Ralstonia solanacearum (strain GMI1000) GN=trpC1 PE=3 SV=1 265 513 1.0E-38
sp|C5CBK6|TRPC_MICLC Indole-3-glycerol phosphate synthase OS=Micrococcus luteus (strain ATCC 4698 / DSM 20030 / JCM 1464 / NBRC 3333 / NCIMB 9278 / NCTC 2665 / VKM Ac-2230) GN=trpC PE=3 SV=1 296 502 1.0E-38
sp|B4RPF1|TRPC_NEIG2 Indole-3-glycerol phosphate synthase OS=Neisseria gonorrhoeae (strain NCCP11945) GN=trpC PE=3 SV=1 248 513 1.0E-38
sp|A3CLL9|TRPC_STRSV Indole-3-glycerol phosphate synthase OS=Streptococcus sanguinis (strain SK36) GN=trpC PE=3 SV=1 295 513 2.0E-38
sp|P57855|TRPC_PASMU Tryptophan biosynthesis protein TrpCF OS=Pasteurella multocida (strain Pm70) GN=trpC PE=3 SV=1 284 743 2.0E-38
sp|A3PHK7|TRPC_RHOS1 Indole-3-glycerol phosphate synthase OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=trpC PE=3 SV=1 304 505 2.0E-38
sp|P71381|TRPG_HAEIN Anthranilate synthase component 2 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=trpG PE=3 SV=1 26 227 2.0E-38
sp|B1Y7I2|TRPC_LEPCP Indole-3-glycerol phosphate synthase OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=trpC PE=3 SV=1 303 513 2.0E-38
sp|B9KMV0|TRPC_RHOSK Indole-3-glycerol phosphate synthase OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=trpC PE=3 SV=1 304 505 2.0E-38
sp|Q73BQ9|TRPC_BACC1 Indole-3-glycerol phosphate synthase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=trpC PE=3 SV=1 304 512 3.0E-38
sp|Q8DVF5|TRPC_STRMU Indole-3-glycerol phosphate synthase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=trpC PE=3 SV=1 268 514 3.0E-38
sp|A8AW03|TRPC_STRGC Indole-3-glycerol phosphate synthase OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=trpC PE=3 SV=1 268 513 3.0E-38
sp|A7INK2|TRPC_XANP2 Indole-3-glycerol phosphate synthase OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=trpC PE=3 SV=1 302 515 3.0E-38
sp|Q01999|TRPC_LACLA Indole-3-glycerol phosphate synthase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=trpC PE=3 SV=1 246 505 3.0E-38
sp|Q46WU7|TRPC_CUPPJ Indole-3-glycerol phosphate synthase OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=trpC PE=3 SV=1 248 513 6.0E-38
sp|B0VUS0|TRPC_ACIBS Indole-3-glycerol phosphate synthase OS=Acinetobacter baumannii (strain SDF) GN=trpC PE=3 SV=1 284 504 6.0E-38
sp|P00906|TRPG_SHIDY Anthranilate synthase component II (Fragment) OS=Shigella dysenteriae GN=trpG-TRPD PE=3 SV=2 26 228 7.0E-38
sp|B0VBS1|TRPC_ACIBY Indole-3-glycerol phosphate synthase OS=Acinetobacter baumannii (strain AYE) GN=trpC PE=3 SV=1 284 504 7.0E-38
sp|A3M785|TRPC_ACIBT Indole-3-glycerol phosphate synthase OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=trpC PE=3 SV=2 284 504 7.0E-38
sp|B7I441|TRPC_ACIB5 Indole-3-glycerol phosphate synthase OS=Acinetobacter baumannii (strain AB0057) GN=trpC PE=3 SV=1 284 504 7.0E-38
sp|A1KRV4|TRPC_NEIMF Indole-3-glycerol phosphate synthase OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=trpC PE=3 SV=1 248 513 7.0E-38
sp|C4KZ66|TRPC_EXISA Indole-3-glycerol phosphate synthase OS=Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b) GN=trpC PE=3 SV=1 267 515 7.0E-38
sp|A7I2Y2|TRPC_CAMHC Indole-3-glycerol phosphate synthase OS=Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 / CH001A) GN=trpC PE=3 SV=1 284 513 9.0E-38
sp|A4YVD6|TRPC_BRASO Indole-3-glycerol phosphate synthase OS=Bradyrhizobium sp. (strain ORS278) GN=trpC PE=3 SV=1 248 507 1.0E-37
sp|B2HVE7|TRPC_ACIBC Indole-3-glycerol phosphate synthase OS=Acinetobacter baumannii (strain ACICU) GN=trpC PE=3 SV=1 284 504 1.0E-37
sp|B1I7S9|TRPC_STRPI Indole-3-glycerol phosphate synthase OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=trpC PE=3 SV=1 266 513 1.0E-37
sp|Q2KU99|TRPC_BORA1 Indole-3-glycerol phosphate synthase OS=Bordetella avium (strain 197N) GN=trpC PE=3 SV=1 248 515 1.0E-37
sp|Q3B2C7|TRPC_CHLL7 Indole-3-glycerol phosphate synthase OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=trpC PE=3 SV=1 258 500 1.0E-37
sp|C1CMD5|TRPC_STRZP Indole-3-glycerol phosphate synthase OS=Streptococcus pneumoniae (strain P1031) GN=trpC PE=3 SV=1 266 513 2.0E-37
sp|B2ISS3|TRPC_STRPS Indole-3-glycerol phosphate synthase OS=Streptococcus pneumoniae (strain CGSP14) GN=trpC PE=3 SV=1 266 513 2.0E-37
sp|Q97P30|TRPC_STRPN Indole-3-glycerol phosphate synthase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=trpC PE=3 SV=1 266 513 2.0E-37
sp|B8ZN61|TRPC_STRPJ Indole-3-glycerol phosphate synthase OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=trpC PE=3 SV=1 266 513 2.0E-37
sp|B5E7M5|TRPC_STRP4 Indole-3-glycerol phosphate synthase OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=trpC PE=3 SV=1 266 513 2.0E-37
sp|C1C968|TRPC_STRP7 Indole-3-glycerol phosphate synthase OS=Streptococcus pneumoniae (strain 70585) GN=trpC PE=3 SV=1 304 513 2.0E-37
sp|B1YSF5|TRPC_BURA4 Indole-3-glycerol phosphate synthase OS=Burkholderia ambifaria (strain MC40-6) GN=trpC PE=3 SV=1 248 503 2.0E-37
sp|A4JB67|TRPC_BURVG Indole-3-glycerol phosphate synthase OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=trpC PE=3 SV=1 248 505 2.0E-37
sp|C1CT53|TRPC_STRZT Indole-3-glycerol phosphate synthase OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=trpC PE=3 SV=1 304 513 2.0E-37
sp|P00905|TRPGD_SALTY Bifunctional protein TrpGD OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=trpGD PE=1 SV=4 26 228 2.0E-37
sp|Q5LYI5|TRPC_STRT1 Indole-3-glycerol phosphate synthase OS=Streptococcus thermophilus (strain CNRZ 1066) GN=trpC PE=3 SV=1 265 513 2.0E-37
sp|Q3AV87|TRPC_SYNS9 Indole-3-glycerol phosphate synthase OS=Synechococcus sp. (strain CC9902) GN=trpC PE=3 SV=1 246 505 2.0E-37
sp|Q03JB9|TRPC_STRTD Indole-3-glycerol phosphate synthase OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=trpC PE=3 SV=1 265 513 2.0E-37
sp|P00911|TRPC_ACIAD Indole-3-glycerol phosphate synthase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=trpC PE=3 SV=2 285 513 2.0E-37
sp|C1DHY7|TRPC_AZOVD Indole-3-glycerol phosphate synthase OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=trpC PE=3 SV=1 303 503 3.0E-37
sp|Q02YB4|TRPC_LACLS Indole-3-glycerol phosphate synthase OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=trpC PE=3 SV=1 246 513 3.0E-37
sp|A2RK21|TRPC_LACLM Indole-3-glycerol phosphate synthase OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=trpC PE=3 SV=1 246 513 3.0E-37
sp|P00900|TRPG_SERMA Anthranilate synthase component 2 OS=Serratia marcescens GN=trpG PE=1 SV=2 26 225 3.0E-37
sp|P26923|TRPG_METTM Anthranilate synthase component 2 OS=Methanothermobacter marburgensis (strain DSM 2133 / 14651 / NBRC 100331 / OCM 82 / Marburg) GN=trpG PE=3 SV=1 28 219 3.0E-37
sp|Q0BIM8|TRPC_BURCM Indole-3-glycerol phosphate synthase OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=trpC PE=3 SV=1 248 503 4.0E-37
sp|Q47QR5|TRPC_THEFY Indole-3-glycerol phosphate synthase OS=Thermobifida fusca (strain YX) GN=trpC PE=3 SV=1 302 521 4.0E-37
sp|A1TJQ2|TRPC_ACIAC Indole-3-glycerol phosphate synthase OS=Acidovorax citrulli (strain AAC00-1) GN=trpC PE=3 SV=1 248 513 4.0E-37
sp|O68427|TRPC_BUCDN Tryptophan biosynthesis protein TrpCF OS=Buchnera aphidicola subsp. Diuraphis noxia GN=trpC PE=3 SV=1 303 754 4.0E-37
sp|Q5M348|TRPC_STRT2 Indole-3-glycerol phosphate synthase OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=trpC PE=3 SV=1 266 513 4.0E-37
sp|Q5KXU9|TRPC_GEOKA Indole-3-glycerol phosphate synthase OS=Geobacillus kaustophilus (strain HTA426) GN=trpC PE=3 SV=1 290 505 4.0E-37
sp|Q1ISJ1|TRPC_KORVE Indole-3-glycerol phosphate synthase OS=Koribacter versatilis (strain Ellin345) GN=trpC PE=3 SV=1 302 513 5.0E-37
sp|C5CKE4|TRPC_VARPS Indole-3-glycerol phosphate synthase OS=Variovorax paradoxus (strain S110) GN=trpC PE=3 SV=1 294 505 5.0E-37
sp|C1CG44|TRPC_STRZJ Indole-3-glycerol phosphate synthase OS=Streptococcus pneumoniae (strain JJA) GN=trpC PE=3 SV=1 304 513 5.0E-37
sp|Q8DNM6|TRPC_STRR6 Indole-3-glycerol phosphate synthase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=trpC PE=3 SV=1 304 513 5.0E-37
sp|Q04IY7|TRPC_STRP2 Indole-3-glycerol phosphate synthase OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=trpC PE=3 SV=1 304 513 5.0E-37
sp|A4XZC5|TRPC_PSEMY Indole-3-glycerol phosphate synthase OS=Pseudomonas mendocina (strain ymp) GN=trpC PE=3 SV=1 303 503 5.0E-37
sp|Q8ZEG6|TRPG_YERPE Anthranilate synthase component 2 OS=Yersinia pestis GN=trpG PE=3 SV=1 26 225 6.0E-37
sp|A5GRL0|TRPC_SYNR3 Indole-3-glycerol phosphate synthase OS=Synechococcus sp. (strain RCC307) GN=trpC PE=3 SV=1 248 516 7.0E-37
sp|A1W2Z8|TRPC_ACISJ Indole-3-glycerol phosphate synthase OS=Acidovorax sp. (strain JS42) GN=trpC PE=3 SV=1 304 513 1.0E-36
sp|A4IQ84|TRPC_GEOTN Indole-3-glycerol phosphate synthase OS=Geobacillus thermodenitrificans (strain NG80-2) GN=trpC PE=3 SV=1 286 505 1.0E-36
sp|A8FEK0|TRPC_BACP2 Indole-3-glycerol phosphate synthase OS=Bacillus pumilus (strain SAFR-032) GN=trpC PE=3 SV=1 302 504 1.0E-36
sp|Q57690|TRPG_METJA Anthranilate synthase component 2 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=trpG PE=3 SV=1 28 217 1.0E-36
sp|B9MBS5|TRPC_ACIET Indole-3-glycerol phosphate synthase OS=Acidovorax ebreus (strain TPSY) GN=trpC PE=3 SV=1 304 513 1.0E-36
sp|A9BBR3|TRPC_PROM4 Indole-3-glycerol phosphate synthase OS=Prochlorococcus marinus (strain MIT 9211) GN=trpC PE=3 SV=1 249 513 1.0E-36
sp|P26938|TRPC_AZOBR Indole-3-glycerol phosphate synthase OS=Azospirillum brasilense GN=trpC PE=3 SV=1 248 507 1.0E-36
sp|Q88A03|TRPC_PSESM Indole-3-glycerol phosphate synthase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=trpC PE=3 SV=1 249 521 3.0E-36
sp|Q8R9M7|TRPC_CALS4 Indole-3-glycerol phosphate synthase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=trpC PE=3 SV=1 302 516 3.0E-36
sp|Q02TB5|TRPC_PSEAB Indole-3-glycerol phosphate synthase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=trpC PE=3 SV=1 249 505 3.0E-36
sp|P20577|TRPC_PSEAE Indole-3-glycerol phosphate synthase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=trpC PE=3 SV=1 249 505 3.0E-36
sp|B7V609|TRPC_PSEA8 Indole-3-glycerol phosphate synthase OS=Pseudomonas aeruginosa (strain LESB58) GN=trpC PE=3 SV=1 249 505 3.0E-36
sp|A6UZF2|TRPC_PSEA7 Indole-3-glycerol phosphate synthase OS=Pseudomonas aeruginosa (strain PA7) GN=trpC PE=3 SV=1 249 505 3.0E-36
sp|Q8AAD6|TRPC_BACTN Indole-3-glycerol phosphate synthase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=trpC PE=3 SV=1 248 504 6.0E-36
sp|A9BS06|TRPC_DELAS Indole-3-glycerol phosphate synthase OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=trpC PE=3 SV=1 304 505 7.0E-36
sp|Q06121|TRPC_SULSO Indole-3-glycerol phosphate synthase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=trpC PE=1 SV=1 303 505 9.0E-36
sp|P00904|TRPGD_ECOLI Bifunctional protein TrpGD OS=Escherichia coli (strain K12) GN=trpGD PE=1 SV=3 26 228 9.0E-36
sp|P57366|TRPC_BUCAI Tryptophan biosynthesis protein TrpCF OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=trpC PE=3 SV=1 287 760 1.0E-35
sp|A5EVG3|TRPC_DICNV Indole-3-glycerol phosphate synthase OS=Dichelobacter nodosus (strain VCS1703A) GN=trpC PE=3 SV=1 302 518 1.0E-35
sp|Q47AC7|TRPC_DECAR Indole-3-glycerol phosphate synthase OS=Dechloromonas aromatica (strain RCB) GN=trpC PE=3 SV=1 248 513 1.0E-35
sp|Q3AL94|TRPC_SYNSC Indole-3-glycerol phosphate synthase OS=Synechococcus sp. (strain CC9605) GN=trpC PE=3 SV=1 286 513 2.0E-35
sp|Q39JZ7|TRPC_BURL3 Indole-3-glycerol phosphate synthase OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=trpC PE=3 SV=1 248 503 2.0E-35
sp|A1KAT2|TRPC_AZOSB Indole-3-glycerol phosphate synthase OS=Azoarcus sp. (strain BH72) GN=trpC PE=3 SV=1 303 505 2.0E-35
sp|Q7TU64|TRPC_PROMP Indole-3-glycerol phosphate synthase OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=trpC PE=3 SV=1 246 505 2.0E-35
sp|Q0RFX9|TRPC_FRAAA Indole-3-glycerol phosphate synthase OS=Frankia alni (strain ACN14a) GN=trpC PE=3 SV=1 295 522 2.0E-35
sp|P13997|TRPF_KLULA N-(5'-phosphoribosyl)anthranilate isomerase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=TRP1 PE=3 SV=1 529 759 2.0E-35
sp|Q2S1Z5|TRPC_SALRD Indole-3-glycerol phosphate synthase OS=Salinibacter ruber (strain DSM 13855 / M31) GN=trpC PE=3 SV=1 302 518 2.0E-35
sp|Q7VAT3|TRPC_PROMA Indole-3-glycerol phosphate synthase OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=trpC PE=3 SV=1 239 513 2.0E-35
sp|A2BY04|TRPC_PROM5 Indole-3-glycerol phosphate synthase OS=Prochlorococcus marinus (strain MIT 9515) GN=trpC PE=3 SV=1 246 505 3.0E-35
sp|A0K458|TRPC_BURCH Indole-3-glycerol phosphate synthase OS=Burkholderia cenocepacia (strain HI2424) GN=trpC PE=3 SV=1 284 503 3.0E-35
sp|B1JUU5|TRPC_BURCC Indole-3-glycerol phosphate synthase OS=Burkholderia cenocepacia (strain MC0-3) GN=trpC PE=3 SV=1 284 503 3.0E-35
sp|Q1BSD2|TRPC_BURCA Indole-3-glycerol phosphate synthase OS=Burkholderia cenocepacia (strain AU 1054) GN=trpC PE=3 SV=1 284 503 3.0E-35
sp|P46451|TRPC_HAEIN Tryptophan biosynthesis protein TrpCF OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=trpC PE=3 SV=1 303 752 4.0E-35
sp|A9AJ43|TRPC_BURM1 Indole-3-glycerol phosphate synthase OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=trpC PE=3 SV=1 303 503 4.0E-35
sp|A6TM74|TRPC_ALKMQ Indole-3-glycerol phosphate synthase OS=Alkaliphilus metalliredigens (strain QYMF) GN=trpC PE=3 SV=1 271 516 4.0E-35
sp|A4J147|TRPC_DESRM Indole-3-glycerol phosphate synthase OS=Desulfotomaculum reducens (strain MI-1) GN=trpC PE=3 SV=1 302 514 4.0E-35
sp|P42393|TRPC_BUCAP Tryptophan biosynthesis protein TrpCF OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=trpC PE=3 SV=1 287 757 6.0E-35
sp|Q48NP7|TRPC_PSE14 Indole-3-glycerol phosphate synthase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=trpC PE=3 SV=1 303 503 9.0E-35
sp|Q4K503|TRPC_PSEF5 Indole-3-glycerol phosphate synthase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=trpC PE=3 SV=1 303 503 9.0E-35
sp|O27693|TRPG_METTH Anthranilate synthase component 2 OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=trpG PE=3 SV=1 28 219 1.0E-34
sp|Q3K5V4|TRPC_PSEPF Indole-3-glycerol phosphate synthase OS=Pseudomonas fluorescens (strain Pf0-1) GN=trpC PE=3 SV=1 303 513 3.0E-34
sp|Q2SUI0|TRPC_BURTA Indole-3-glycerol phosphate synthase OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=trpC PE=3 SV=1 291 505 3.0E-34
sp|C5D3D6|TRPC_GEOSW Indole-3-glycerol phosphate synthase OS=Geobacillus sp. (strain WCH70) GN=trpC PE=3 SV=1 295 513 4.0E-34
sp|A1WH73|TRPC_VEREI Indole-3-glycerol phosphate synthase OS=Verminephrobacter eiseniae (strain EF01-2) GN=trpC PE=3 SV=1 294 513 6.0E-34
sp|Q5V632|TRPG2_HALMA Anthranilate synthase component II OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=trpG2 PE=3 SV=1 28 216 6.0E-34
sp|B8HP79|TRPC_CYAP4 Indole-3-glycerol phosphate synthase OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=trpC PE=3 SV=1 249 502 7.0E-34
sp|O25867|TRPC_HELPY Tryptophan biosynthesis protein TrpCF OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=trpC PE=3 SV=1 303 752 8.0E-34
sp|A3PED0|TRPC_PROM0 Indole-3-glycerol phosphate synthase OS=Prochlorococcus marinus (strain MIT 9301) GN=trpC PE=3 SV=1 246 505 9.0E-34
sp|A3NDZ3|TRPC_BURP6 Indole-3-glycerol phosphate synthase OS=Burkholderia pseudomallei (strain 668) GN=trpC PE=3 SV=1 291 505 1.0E-33
sp|Q02003|TRPG_LACLA Anthranilate synthase component 2 OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=trpG PE=3 SV=1 28 217 1.0E-33
sp|A2BSL8|TRPC_PROMS Indole-3-glycerol phosphate synthase OS=Prochlorococcus marinus (strain AS9601) GN=trpC PE=3 SV=1 246 505 1.0E-33
sp|P22101|TRPG_VIBPA Anthranilate synthase component 2 OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=trpG PE=3 SV=1 26 215 1.0E-33
sp|Q3JNB0|TRPC_BURP1 Indole-3-glycerol phosphate synthase OS=Burkholderia pseudomallei (strain 1710b) GN=trpC PE=3 SV=1 291 505 2.0E-33
sp|Q63QH0|TRPC_BURPS Indole-3-glycerol phosphate synthase OS=Burkholderia pseudomallei (strain K96243) GN=trpC PE=3 SV=1 291 505 2.0E-33
sp|A3NZP6|TRPC_BURP0 Indole-3-glycerol phosphate synthase OS=Burkholderia pseudomallei (strain 1106a) GN=trpC PE=3 SV=1 291 505 2.0E-33
sp|B1JE34|TRPC_PSEPW Indole-3-glycerol phosphate synthase OS=Pseudomonas putida (strain W619) GN=trpC PE=3 SV=1 296 503 2.0E-33
sp|B0CEU2|TRPC_ACAM1 Indole-3-glycerol phosphate synthase OS=Acaryochloris marina (strain MBIC 11017) GN=trpC PE=3 SV=1 249 502 2.0E-33
sp|C3K307|TRPC_PSEFS Indole-3-glycerol phosphate synthase OS=Pseudomonas fluorescens (strain SBW25) GN=trpC PE=3 SV=1 303 505 3.0E-33
sp|Q319J2|TRPC_PROM9 Indole-3-glycerol phosphate synthase OS=Prochlorococcus marinus (strain MIT 9312) GN=trpC PE=3 SV=1 246 505 3.0E-33
sp|A0LJ58|TRPC_SYNFM Indole-3-glycerol phosphate synthase OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=trpC PE=3 SV=1 248 513 4.0E-33
sp|Q01128|TRPF_LIPST N-(5'-phosphoribosyl)anthranilate isomerase OS=Lipomyces starkeyi GN=TRP1 PE=3 SV=1 530 761 4.0E-33
sp|P70937|TRPC_BACMQ Indole-3-glycerol phosphate synthase OS=Bacillus megaterium (strain ATCC 12872 / QMB1551) GN=trpC PE=3 SV=1 291 518 5.0E-33
sp|A1UWA0|TRPC_BURMS Indole-3-glycerol phosphate synthase OS=Burkholderia mallei (strain SAVP1) GN=trpC PE=3 SV=1 291 505 7.0E-33
sp|Q62DD0|TRPC_BURMA Indole-3-glycerol phosphate synthase OS=Burkholderia mallei (strain ATCC 23344) GN=trpC PE=3 SV=1 291 505 7.0E-33
sp|A2RYI3|TRPC_BURM9 Indole-3-glycerol phosphate synthase OS=Burkholderia mallei (strain NCTC 10229) GN=trpC PE=3 SV=1 291 505 7.0E-33
sp|A3MFQ4|TRPC_BURM7 Indole-3-glycerol phosphate synthase OS=Burkholderia mallei (strain NCTC 10247) GN=trpC PE=3 SV=1 291 505 7.0E-33
sp|Q89A30|TRPG_BUCBP Anthranilate synthase component 2 OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=trpG PE=3 SV=1 27 217 9.0E-33
sp|A8G6A7|TRPC_PROM2 Indole-3-glycerol phosphate synthase OS=Prochlorococcus marinus (strain MIT 9215) GN=trpC PE=3 SV=1 246 505 1.0E-32
sp|P49572|TRPC_ARATH Indole-3-glycerol phosphate synthase, chloroplastic OS=Arabidopsis thaliana GN=At2g04400 PE=2 SV=2 249 505 1.0E-32
sp|P26939|TRPC_METTM Indole-3-glycerol phosphate synthase OS=Methanothermobacter marburgensis (strain DSM 2133 / 14651 / NBRC 100331 / OCM 82 / Marburg) GN=trpC PE=3 SV=1 249 518 1.0E-32
sp|Q9KST3|TRPG_VIBCH Anthranilate synthase component 2 OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=trpG PE=3 SV=2 26 215 1.0E-32
sp|A0LA39|TRPC_MAGMM Indole-3-glycerol phosphate synthase OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=trpC PE=3 SV=1 249 502 1.0E-32
sp|O13504|TRPF_PICPA N-(5'-phosphoribosyl)anthranilate isomerase OS=Komagataella pastoris GN=TRP1 PE=3 SV=1 530 759 1.0E-32
sp|P32483|PABS_STRGR Para-aminobenzoate synthase OS=Streptomyces griseus GN=pab PE=3 SV=1 29 216 1.0E-32
sp|Q88QR6|TRPC_PSEPK Indole-3-glycerol phosphate synthase OS=Pseudomonas putida (strain KT2440) GN=trpC PE=3 SV=1 296 503 1.0E-32
sp|Q65I33|TRPC_BACLD Indole-3-glycerol phosphate synthase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=trpC PE=3 SV=1 302 502 1.0E-32
sp|Q02584|TRPC_RHOCB Indole-3-glycerol phosphate synthase OS=Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003) GN=trpC PE=3 SV=2 248 507 1.0E-32
sp|P9WN35|TRPG_MYCTU Anthranilate synthase component 2 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=trpG PE=1 SV=1 28 230 1.0E-32
sp|P9WN34|TRPG_MYCTO Anthranilate synthase component 2 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=trpG PE=3 SV=1 28 230 1.0E-32
sp|Q7TV44|TRPC_PROMM Indole-3-glycerol phosphate synthase OS=Prochlorococcus marinus (strain MIT 9313) GN=trpC PE=3 SV=1 291 518 2.0E-32
sp|P20578|TRPC_PSEPU Indole-3-glycerol phosphate synthase OS=Pseudomonas putida GN=trpC PE=3 SV=1 296 503 2.0E-32
sp|A5VXL5|TRPC_PSEP1 Indole-3-glycerol phosphate synthase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=trpC PE=3 SV=1 296 503 2.0E-32
sp|A2CB59|TRPC_PROM3 Indole-3-glycerol phosphate synthase OS=Prochlorococcus marinus (strain MIT 9303) GN=trpC PE=3 SV=1 291 518 2.0E-32
sp|Q7NHI0|TRPC_GLOVI Indole-3-glycerol phosphate synthase OS=Gloeobacter violaceus (strain PCC 7421) GN=trpC PE=3 SV=1 247 516 4.0E-32
sp|Q1IFZ9|TRPC_PSEE4 Indole-3-glycerol phosphate synthase OS=Pseudomonas entomophila (strain L48) GN=trpC PE=3 SV=1 296 513 5.0E-32
sp|Q9Z4X0|TRPC2_STRCO Indole-3-glycerol phosphate synthase 2 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=trpC2 PE=3 SV=1 248 513 5.0E-32
sp|Q5N575|TRPC_SYNP6 Indole-3-glycerol phosphate synthase OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=trpC PE=3 SV=1 291 521 5.0E-32
sp|Q8KPR4|TRPC_SYNE7 Indole-3-glycerol phosphate synthase OS=Synechococcus elongatus (strain PCC 7942) GN=trpC PE=3 SV=2 291 521 5.0E-32
sp|Q2RT48|TRPC_RHORT Indole-3-glycerol phosphate synthase OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=trpC PE=3 SV=1 303 505 6.0E-32
sp|A5GMK4|TRPC_SYNPW Indole-3-glycerol phosphate synthase OS=Synechococcus sp. (strain WH7803) GN=trpC PE=3 SV=1 248 502 6.0E-32
sp|B0KK35|TRPC_PSEPG Indole-3-glycerol phosphate synthase OS=Pseudomonas putida (strain GB-1) GN=trpC PE=3 SV=1 296 503 7.0E-32
sp|Q5XQP9|TRPF_SACK1 N-(5'-phosphoribosyl)anthranilate isomerase OS=Saccharomyces kudriavzevii (strain ATCC MYA-4449 / AS 2.2408 / CBS 8840 / NBRC 1802 / NCYC 2889) GN=TRP1 PE=3 SV=1 530 760 8.0E-32
sp|Q8F7V2|TRPC_LEPIN Indole-3-glycerol phosphate synthase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=trpC PE=3 SV=1 264 505 1.0E-31
sp|Q72NP6|TRPC_LEPIC Indole-3-glycerol phosphate synthase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=trpC PE=3 SV=1 264 505 1.0E-31
sp|Q13TW4|TRPC_BURXL Indole-3-glycerol phosphate synthase OS=Burkholderia xenovorans (strain LB400) GN=trpC PE=3 SV=1 303 513 1.0E-31
sp|Q06129|TRPG_SULSO Anthranilate synthase component 2 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=trpG PE=1 SV=2 29 217 1.0E-31
sp|Q9ZJU8|TRPC_HELPJ Tryptophan biosynthesis protein TrpCF OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=trpC PE=3 SV=1 303 752 1.0E-31
sp|P03964|TRPC_BACSU Indole-3-glycerol phosphate synthase OS=Bacillus subtilis (strain 168) GN=trpC PE=3 SV=3 302 502 2.0E-31
sp|Q9YGB2|TRPG_THEKO Anthranilate synthase component 2 OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=trpG PE=3 SV=1 28 219 2.0E-31
sp|P42388|TRPG_BUCAP Anthranilate synthase component 2 OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=trpG PE=3 SV=1 26 217 2.0E-31
sp|Q4J8X3|TRPC_SULAC Indole-3-glycerol phosphate synthase OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=trpC PE=3 SV=1 304 502 3.0E-31
sp|A5VBA0|TRPC_SPHWW Indole-3-glycerol phosphate synthase OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=trpC PE=3 SV=1 304 517 3.0E-31
sp|A4VHK1|TRPC_PSEU5 Indole-3-glycerol phosphate synthase OS=Pseudomonas stutzeri (strain A1501) GN=trpC PE=3 SV=1 249 513 4.0E-31
sp|Q44696|TRPG_BUCAI Anthranilate synthase component 2 OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=trpG PE=3 SV=2 26 229 4.0E-31
sp|Q972A1|TRPC_SULTO Indole-3-glycerol phosphate synthase OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=trpC PE=3 SV=1 291 505 8.0E-31
sp|P50857|TRPF_CANGA N-(5'-phosphoribosyl)anthranilate isomerase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=TRP1 PE=3 SV=2 530 760 1.0E-30
sp|B2SZ04|TRPC_BURPP Indole-3-glycerol phosphate synthase OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=trpC PE=3 SV=1 303 513 1.0E-30
sp|P59459|TRPC_BUCBP Tryptophan biosynthesis protein TrpCF OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=trpC PE=3 SV=1 263 755 2.0E-30
sp|Q875I3|TRPF_WICAO N-(5'-phosphoribosyl)anthranilate isomerase OS=Wickerhamomyces anomalus GN=TRP1 PE=3 SV=1 529 759 3.0E-30
sp|P00912|TRPF_YEAST N-(5'-phosphoribosyl)anthranilate isomerase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TRP1 PE=1 SV=2 530 760 4.0E-30
sp|Q4L677|TRPC_STAHJ Indole-3-glycerol phosphate synthase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=trpC PE=3 SV=1 301 513 7.0E-30
sp|Q0IC57|TRPC_SYNS3 Indole-3-glycerol phosphate synthase OS=Synechococcus sp. (strain CC9311) GN=trpC PE=3 SV=1 248 516 1.0E-29
sp|A9BHQ5|TRPC_PETMO Indole-3-glycerol phosphate synthase OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=trpC PE=3 SV=1 302 513 1.0E-29
sp|Q0C1A2|TRPC_HYPNA Indole-3-glycerol phosphate synthase OS=Hyphomonas neptunium (strain ATCC 15444) GN=trpC PE=3 SV=1 303 502 1.0E-29
sp|A7Z618|TRPC_BACMF Indole-3-glycerol phosphate synthase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=trpC PE=3 SV=1 302 502 3.0E-29
sp|P18304|TRPC_HALVD Indole-3-glycerol phosphate synthase OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=trpC PE=3 SV=1 302 501 3.0E-29
sp|O19914|TRPG_CYACA Anthranilate synthase component 2 OS=Cyanidium caldarium GN=trpG PE=3 SV=1 28 222 1.0E-28
sp|Q56319|TRPC_THEMA Indole-3-glycerol phosphate synthase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=trpC PE=1 SV=3 302 513 2.0E-28
sp|P50872|TRPE_AZOBR Anthranilate synthase OS=Azospirillum brasilense GN=trpE(G) PE=3 SV=1 4 209 5.0E-28
sp|A6QGS2|TRPC_STAAE Indole-3-glycerol phosphate synthase OS=Staphylococcus aureus (strain Newman) GN=trpC PE=3 SV=1 291 513 8.0E-28
sp|Q9RL78|TRPC_STAAC Indole-3-glycerol phosphate synthase OS=Staphylococcus aureus (strain COL) GN=trpC PE=3 SV=1 291 513 8.0E-28
sp|A2C462|TRPC_PROM1 Indole-3-glycerol phosphate synthase OS=Prochlorococcus marinus (strain NATL1A) GN=trpC PE=3 SV=1 244 505 8.0E-28
sp|Q46JH4|TRPC_PROMT Indole-3-glycerol phosphate synthase OS=Prochlorococcus marinus (strain NATL2A) GN=trpC PE=3 SV=1 244 505 9.0E-28
sp|Q8CPB2|TRPC_STAES Indole-3-glycerol phosphate synthase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=trpC PE=3 SV=1 302 513 1.0E-27
sp|Q5HPH2|TRPC_STAEQ Indole-3-glycerol phosphate synthase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=trpC PE=3 SV=1 302 513 1.0E-27
sp|P09786|PHNB_PSEAE Anthranilate synthase component 2, pyocyanine specific OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=phnB PE=1 SV=3 28 232 1.0E-27
sp|Q8NWU3|TRPC_STAAW Indole-3-glycerol phosphate synthase OS=Staphylococcus aureus (strain MW2) GN=trpC PE=3 SV=1 291 513 2.0E-27
sp|A8Z242|TRPC_STAAT Indole-3-glycerol phosphate synthase OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=trpC PE=3 SV=1 291 513 2.0E-27
sp|Q6G9I9|TRPC_STAAS Indole-3-glycerol phosphate synthase OS=Staphylococcus aureus (strain MSSA476) GN=trpC PE=3 SV=1 291 513 2.0E-27
sp|Q2FYR6|TRPC_STAA8 Indole-3-glycerol phosphate synthase OS=Staphylococcus aureus (strain NCTC 8325) GN=trpC PE=3 SV=1 291 513 2.0E-27
sp|Q2FH66|TRPC_STAA3 Indole-3-glycerol phosphate synthase OS=Staphylococcus aureus (strain USA300) GN=trpC PE=3 SV=1 291 513 2.0E-27
sp|P66991|TRPC_STAAN Indole-3-glycerol phosphate synthase OS=Staphylococcus aureus (strain N315) GN=trpC PE=3 SV=1 291 513 2.0E-27
sp|P66990|TRPC_STAAM Indole-3-glycerol phosphate synthase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=trpC PE=3 SV=1 291 513 2.0E-27
sp|A5ISQ2|TRPC_STAA9 Indole-3-glycerol phosphate synthase OS=Staphylococcus aureus (strain JH9) GN=trpC PE=3 SV=1 291 513 2.0E-27
sp|A6U1J2|TRPC_STAA2 Indole-3-glycerol phosphate synthase OS=Staphylococcus aureus (strain JH1) GN=trpC PE=3 SV=1 291 513 2.0E-27
sp|A7X234|TRPC_STAA1 Indole-3-glycerol phosphate synthase OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=trpC PE=3 SV=1 291 513 2.0E-27
sp|Q6GH35|TRPC_STAAR Indole-3-glycerol phosphate synthase OS=Staphylococcus aureus (strain MRSA252) GN=trpC PE=3 SV=1 291 513 2.0E-27
sp|A4YHD8|TRPC_METS5 Indole-3-glycerol phosphate synthase OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=trpC PE=3 SV=1 290 516 3.0E-27
sp|Q8TVJ8|TRPC_METKA Indole-3-glycerol phosphate synthase OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=trpC PE=3 SV=1 302 518 7.0E-27
sp|O27694|TRPC_METTH Indole-3-glycerol phosphate synthase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=trpC PE=3 SV=1 302 513 2.0E-26
sp|Q49XH6|TRPC_STAS1 Indole-3-glycerol phosphate synthase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=trpC PE=3 SV=1 290 510 3.0E-26
sp|P27627|PABA_STRLI Aminodeoxychorismate synthase component 2 OS=Streptomyces lividans PE=3 SV=1 26 217 3.0E-26
sp|Q2YXU9|TRPC_STAAB Indole-3-glycerol phosphate synthase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=trpC PE=3 SV=1 302 513 4.0E-26
sp|Q58328|TRPC_METJA Indole-3-glycerol phosphate synthase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=trpC PE=3 SV=1 250 505 6.0E-26
sp|Q9HSC1|TRPC_HALSA Indole-3-glycerol phosphate synthase OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=trpC PE=3 SV=1 304 504 7.0E-26
sp|Q8ESU3|TRPF_OCEIH N-(5'-phosphoribosyl)anthranilate isomerase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=trpF PE=3 SV=1 529 756 4.0E-25
sp|O28670|TRPG_ARCFU Anthranilate synthase component 2 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=trpG PE=3 SV=1 28 219 4.0E-25
sp|O25868|TRPG_HELPY Anthranilate synthase component 2 OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=trpG PE=3 SV=1 28 214 6.0E-25
sp|Q9ZJU6|TRPG_HELPJ Anthranilate synthase component 2 OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=trpG PE=3 SV=1 28 214 7.0E-25
sp|Q5V138|TRPC_HALMA Indole-3-glycerol phosphate synthase OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=trpC PE=3 SV=1 304 501 3.0E-24
sp|Q9YGB5|TRPC_THEKO Indole-3-glycerol phosphate synthase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=trpC PE=3 SV=2 303 513 3.0E-24
sp|P14952|TRPG_CLOTM Anthranilate synthase component 2 (Fragment) OS=Clostridium thermocellum GN=trpG PE=3 SV=1 27 112 7.0E-24
sp|Q9Y8T7|TRPC_AERPE Indole-3-glycerol phosphate synthase OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=trpC PE=3 SV=1 293 504 9.0E-24
sp|B1LA13|TRPF_THESQ N-(5'-phosphoribosyl)anthranilate isomerase OS=Thermotoga sp. (strain RQ2) GN=trpF PE=3 SV=1 531 762 1.0E-23
sp|A5IKT2|TRPF_THEP1 N-(5'-phosphoribosyl)anthranilate isomerase OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=trpF PE=3 SV=1 531 762 1.0E-23
sp|P15395|TRPE_RHIME Anthranilate synthase OS=Rhizobium meliloti (strain 1021) GN=trpE(G) PE=3 SV=1 27 217 1.0E-23
sp|Q9HFW8|TRPF_ZYGBA N-(5'-phosphoribosyl)anthranilate isomerase OS=Zygosaccharomyces bailii GN=TRP1 PE=3 SV=1 529 760 2.0E-23
sp|Q6TAS3|ADCS_SOLLC Aminodeoxychorismate synthase, chloroplastic OS=Solanum lycopersicum GN=ADCS PE=2 SV=1 29 224 3.0E-23
sp|P06560|TRPC_CORGL Tryptophan biosynthesis protein TrpCF OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=trpC PE=3 SV=2 273 742 3.0E-23
sp|Q8LPN3|ADCS_ARATH Aminodeoxychorismate synthase, chloroplastic OS=Arabidopsis thaliana GN=ADCS PE=1 SV=1 29 234 8.0E-23
sp|Q5Z856|ADCS_ORYSJ Probable aminodeoxychorismate synthase, chloroplastic OS=Oryza sativa subsp. japonica GN=ADCS PE=2 SV=1 29 216 9.0E-23
sp|P06558|TRPG_CORGL Anthranilate synthase component 2 OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=trpG PE=3 SV=2 26 209 1.0E-22
sp|Q56320|TRPF_THEMA N-(5'-phosphoribosyl)anthranilate isomerase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=trpF PE=1 SV=1 531 762 1.0E-22
sp|P43073|TRPF_CANAL N-(5'-phosphoribosyl)anthranilate isomerase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TRP1 PE=3 SV=2 530 757 2.0E-22
sp|Q9RUG0|TRPC_DEIRA Indole-3-glycerol phosphate synthase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=trpC PE=3 SV=1 291 504 7.0E-21
sp|Q9V1G3|TRPC_PYRAB Indole-3-glycerol phosphate synthase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=trpC PE=3 SV=1 292 505 2.0E-20
sp|B9K6Z3|TRPF_THENN N-(5'-phosphoribosyl)anthranilate isomerase OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=trpF PE=3 SV=1 531 762 3.0E-20
sp|Q8ZYX2|TRPC_PYRAE Indole-3-glycerol phosphate synthase OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=trpC PE=3 SV=1 287 513 7.0E-20
sp|A4WN19|TRPC_PYRAR Indole-3-glycerol phosphate synthase OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=trpC PE=3 SV=1 287 504 9.0E-20
sp|Q02002|TRPF_LACLA N-(5'-phosphoribosyl)anthranilate isomerase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=trpF PE=3 SV=1 529 759 1.0E-19
sp|B1YBK5|TRPC_PYRNV Indole-3-glycerol phosphate synthase OS=Pyrobaculum neutrophilum (strain DSM 2338 / JCM 9278 / V24Sta) GN=trpC PE=3 SV=1 287 504 2.0E-19
sp|P17218|TRPF_LACCA N-(5'-phosphoribosyl)anthranilate isomerase OS=Lactobacillus casei GN=trpF PE=3 SV=1 529 760 1.0E-18
sp|Q8U088|TRPC_PYRFU Indole-3-glycerol phosphate synthase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=trpC PE=3 SV=1 304 513 3.0E-18
sp|Q757J9|TRPF_ASHGO N-(5'-phosphoribosyl)anthranilate isomerase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=TRP1 PE=3 SV=1 529 762 3.0E-18
sp|P44339|Y1171_HAEIN Putative anthranilate synthase component II OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_1171 PE=3 SV=1 28 217 6.0E-18
sp|Q8TXV8|GUAAA_METKA GMP synthase [glutamine-hydrolyzing] subunit A OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=guaAA PE=3 SV=1 28 221 9.0E-18
sp|Q39SQ9|TRPF_GEOMG N-(5'-phosphoribosyl)anthranilate isomerase OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=trpF PE=3 SV=1 529 760 9.0E-18
sp|A0AJ81|TRPF_LISW6 N-(5'-phosphoribosyl)anthranilate isomerase OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=trpF PE=3 SV=1 529 762 9.0E-18
sp|B3W6W7|TRPF_LACCB N-(5'-phosphoribosyl)anthranilate isomerase OS=Lactobacillus casei (strain BL23) GN=trpF PE=3 SV=1 529 760 2.0E-17
sp|Q74AH7|TRPF_GEOSL N-(5'-phosphoribosyl)anthranilate isomerase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=trpF PE=3 SV=1 529 761 2.0E-17
sp|Q3ZZ13|TRPF_DEHMC N-(5'-phosphoribosyl)anthranilate isomerase OS=Dehalococcoides mccartyi (strain CBDB1) GN=trpF PE=3 SV=1 529 760 2.0E-17
sp|Q3Z6G4|TRPF_DEHM1 N-(5'-phosphoribosyl)anthranilate isomerase OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=trpF PE=3 SV=1 529 760 3.0E-17
sp|Q03CY2|TRPF_LACC3 N-(5'-phosphoribosyl)anthranilate isomerase OS=Lactobacillus casei (strain ATCC 334) GN=trpF PE=3 SV=1 529 760 3.0E-17
sp|Q0B004|TRPF_SYNWW N-(5'-phosphoribosyl)anthranilate isomerase OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=trpF PE=3 SV=1 531 756 6.0E-17
sp|B1I3Z6|TRPF_DESAP N-(5'-phosphoribosyl)anthranilate isomerase OS=Desulforudis audaxviator (strain MP104C) GN=trpF PE=3 SV=1 530 760 1.0E-16
sp|O28671|TRPF_ARCFU N-(5'-phosphoribosyl)anthranilate isomerase OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=trpF PE=3 SV=1 529 760 3.0E-16
sp|O28668|TRPCD_ARCFU Tryptophan biosynthesis protein TrpCD OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=trpCD PE=3 SV=1 303 518 3.0E-16
sp|C6DYM2|TRPF_GEOSM N-(5'-phosphoribosyl)anthranilate isomerase OS=Geobacter sp. (strain M21) GN=trpF PE=3 SV=1 531 762 5.0E-16
sp|Q8DVF4|TRPF_STRMU N-(5'-phosphoribosyl)anthranilate isomerase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=trpF PE=3 SV=1 531 760 5.0E-16
sp|A7NS83|TRPF_ROSCS N-(5'-phosphoribosyl)anthranilate isomerase OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=trpF PE=3 SV=1 529 751 2.0E-15
sp|Q92B80|TRPF_LISIN N-(5'-phosphoribosyl)anthranilate isomerase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=trpF PE=3 SV=1 529 762 2.0E-15
sp|Q67PJ5|TRPF_SYMTH N-(5'-phosphoribosyl)anthranilate isomerase OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=trpF PE=3 SV=1 529 762 2.0E-15
sp|B5EBV0|TRPF_GEOBB N-(5'-phosphoribosyl)anthranilate isomerase OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=trpF PE=3 SV=1 531 760 2.0E-15
sp|Q8Y6Q5|TRPF_LISMO N-(5'-phosphoribosyl)anthranilate isomerase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=trpF PE=3 SV=1 529 762 3.0E-15
sp|B8DHB3|TRPF_LISMH N-(5'-phosphoribosyl)anthranilate isomerase OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=trpF PE=3 SV=1 529 762 3.0E-15
sp|A8AW04|TRPF_STRGC N-(5'-phosphoribosyl)anthranilate isomerase OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=trpF PE=3 SV=1 531 760 4.0E-15
sp|O94277|PABS_SCHPO Putative aminodeoxychorismate synthase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBP8B7.29 PE=3 SV=1 28 217 4.0E-15
sp|Q8R9M8|TRPF_CALS4 N-(5'-phosphoribosyl)anthranilate isomerase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=trpF PE=3 SV=1 531 762 7.0E-15
sp|B3E754|TRPF_GEOLS N-(5'-phosphoribosyl)anthranilate isomerase OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=trpF PE=3 SV=1 529 760 8.0E-15
[Show less]

GO

GO Term Description Terminal node
GO:0004425 indole-3-glycerol-phosphate synthase activity Yes
GO:0016787 hydrolase activity Yes
GO:0006568 tryptophan metabolic process Yes
GO:0004640 phosphoribosylanthranilate isomerase activity Yes
GO:0046483 heterocycle metabolic process No
GO:0009987 cellular process No
GO:0044106 cellular amine metabolic process No
GO:0006576 cellular biogenic amine metabolic process No
GO:0042430 indole-containing compound metabolic process No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0009072 aromatic amino acid family metabolic process No
GO:0006520 cellular amino acid metabolic process No
GO:0044281 small molecule metabolic process No
GO:0044238 primary metabolic process No
GO:0043436 oxoacid metabolic process No
GO:0006082 organic acid metabolic process No
GO:1901605 alpha-amino acid metabolic process No
GO:0019752 carboxylic acid metabolic process No
GO:0009308 amine metabolic process No
GO:0016831 carboxy-lyase activity No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0003824 catalytic activity No
GO:0006586 indolalkylamine metabolic process No
GO:0044237 cellular metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0016860 intramolecular oxidoreductase activity No
GO:1901360 organic cyclic compound metabolic process No
GO:0016861 intramolecular oxidoreductase activity, interconverting aldoses and ketoses No
GO:0016829 lyase activity No
GO:0016830 carbon-carbon lyase activity No
GO:0003674 molecular_function No
GO:0071704 organic substance metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0016853 isomerase activity No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4493
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3830 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|6761
Ophiocordyceps camponoti-floridani Ophcf2|01275
Ophiocordyceps camponoti-rufipedis Ophun1|792
Ophiocordyceps kimflemingae Ophio5|1049
Ophiocordyceps subramaniannii Hirsu2|9373

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|3830
MASTAAGLVDYSPHQPDASPRVPTASNLILIDNYDSFTWNIYQYLVLEGATVHVFRNDQITLEELVEKKPTQLII
SPGPGHPATDSGISRDVIRHFAGKVPIFGVCMGLQCMFDVYGGEVRSAGEWLHGKTSPLTHDSKGVFANLEQQIP
VTRYHSLAGTHVTLPECLEISSWVANPDGSRGIIQGIRHKVLTLEGVQFHPESILTAHGRKMIKNFLLMQGGTWA
ENERLQAERAASAPPTPIKPKGNNILQTIYAHRKAAVAVQRQIPSQRMEDMQAAHHLDAAPPLVPFVSRLRQSPF
DVALMAEIKRASPSKGIFALDINAPTQARKYALAGASVISVLTEPEWFKGSIQDLRAVRQVLDGMPNRPAILRKD
FIFDEYQILEARLEGADSVLLIVKMLDQALLQRLYDYSVSLGMEPLVEVQNAQEMIIAVNLGAKVIGVNNRNLES
FEVDLDTTGRLRSMVPEQTLICALSGINTHDDVLMNKRDGVNAVLVGEAIMRAPDASVFISELCSGSKPPAKAPS
PSSLMVKICGTRSLEAAQRAMEAGADFVGICLVPGAKRCISHDAALAISKALRSFAGSQAPREQPAKLPVNTAMD
FFASTEERLGSGRPRLVGIFQNQPLSHVLDKQRQYNLDMVQLHGDEPIEWARLIPVPVIRCFKPGQVGIGKRGYH
ILPLLDSGSGSGKMLDVSNVKAVLQQDPDLRVFLAGGLNPDNVASAVEALGELGHRVLGVDVSSGVEVDGKQDLD
KISAFIKAAKGLR*
Coding >OphauG2|3830
ATGGCATCAACAGCAGCAGGCCTCGTAGATTACTCGCCGCACCAACCTGATGCCTCTCCCCGCGTGCCAACCGCG
TCCAATCTGATTCTCATTGACAACTATGACTCCTTCACCTGGAACATATACCAGTATCTGGTTCTCGAAGGCGCC
ACGGTGCACGTCTTCAGAAATGACCAGATCACGCTGGAGGAACTCGTGGAGAAGAAGCCGACGCAGCTCATCATC
AGTCCGGGGCCTGGGCACCCTGCCACCGATTCAGGCATCAGCCGCGATGTCATTAGGCATTTTGCGGGCAAGGTT
CCCATTTTTGGGGTCTGCATGGGACTACAGTGCATGTTTGACGTCTATGGCGGCGAGGTCAGGTCGGCGGGAGAA
TGGCTCCATGGCAAAACATCGCCCCTGACTCACGACTCCAAGGGCGTCTTTGCCAACCTGGAGCAGCAAATTCCC
GTCACCAGATATCATTCTCTGGCTGGGACGCACGTGACGCTGCCCGAGTGCCTCGAGATATCGTCGTGGGTGGCC
AATCCTGACGGCTCACGCGGCATCATTCAGGGCATTCGCCACAAAGTCTTGACCCTGGAAGGCGTCCAGTTCCAT
CCCGAGAGCATTCTCACCGCCCACGGCCGCAAGATGATTAAGAATTTCTTGCTTATGCAGGGCGGCACCTGGGCT
GAAAACGAGCGTCTGCAAGCCGAGCGCGCTGCCTCTGCACCGCCAACGCCCATAAAGCCCAAGGGCAACAATATT
CTGCAGACAATATATGCCCATCGCAAAGCTGCCGTCGCCGTCCAGCGACAAATTCCGTCGCAAAGAATGGAGGAC
ATGCAAGCTGCCCATCATCTTGACGCTGCTCCTCCTCTTGTTCCCTTTGTCAGCCGTTTGCGCCAGTCGCCCTTT
GACGTGGCTCTCATGGCCGAAATCAAACGTGCCTCGCCGTCAAAAGGCATCTTTGCCCTTGATATCAATGCGCCG
ACCCAGGCACGCAAGTATGCCCTGGCAGGAGCCAGTGTCATCTCGGTCCTGACGGAGCCCGAGTGGTTCAAGGGA
AGTATCCAGGACCTGAGGGCAGTGAGACAGGTGCTGGACGGCATGCCAAACAGACCTGCCATCCTGCGAAAGGAC
TTCATCTTTGACGAGTATCAGATTCTAGAGGCCAGATTGGAAGGGGCAGACAGCGTTCTGCTCATCGTCAAGATG
CTCGACCAAGCCTTGCTTCAGCGCCTCTATGACTACTCCGTCTCCCTGGGCATGGAGCCGCTGGTTGAAGTCCAG
AATGCCCAGGAAATGATAATTGCTGTCAACCTTGGAGCCAAGGTGATTGGAGTCAACAACCGCAACCTCGAGAGC
TTCGAGGTGGATCTCGACACGACGGGGCGCCTACGCAGCATGGTGCCTGAACAAACCCTCATATGTGCTCTCAGC
GGCATCAACACCCACGACGATGTGCTTATGAACAAAAGGGACGGAGTCAATGCCGTGCTTGTTGGAGAGGCAATT
ATGCGTGCTCCGGATGCCAGCGTCTTCATTAGCGAGCTCTGCTCAGGCTCCAAGCCGCCGGCGAAAGCGCCGTCT
CCCTCGTCTCTCATGGTCAAGATTTGTGGCACGCGCAGTCTTGAAGCTGCACAGCGGGCTATGGAGGCGGGGGCT
GACTTTGTCGGCATCTGCTTGGTGCCCGGTGCCAAACGCTGTATATCCCACGATGCAGCATTGGCCATTTCCAAA
GCCCTTCGTTCGTTTGCTGGCTCGCAGGCCCCACGGGAGCAACCGGCCAAACTGCCAGTCAATACTGCCATGGAC
TTTTTCGCTTCGACTGAGGAACGATTGGGCAGTGGCCGCCCACGCCTTGTGGGCATTTTCCAAAACCAGCCTCTC
AGTCATGTGCTGGATAAGCAGAGGCAGTATAACCTTGACATGGTGCAGCTTCATGGCGACGAGCCCATTGAATGG
GCCAGGCTGATTCCTGTCCCCGTAATCCGCTGTTTCAAGCCTGGGCAGGTTGGCATTGGCAAGCGCGGCTACCAT
ATACTTCCCTTGCTGGACTCGGGCTCGGGCTCGGGCAAGATGCTCGACGTGTCGAATGTCAAGGCTGTGCTGCAG
CAGGATCCAGATCTCAGGGTGTTTCTAGCTGGTGGCTTGAATCCAGATAATGTAGCGTCAGCGGTTGAAGCCCTG
GGCGAGCTGGGTCATCGAGTGCTGGGTGTTGATGTGAGCAGTGGAGTAGAGGTGGATGGGAAGCAAGACTTGGAC
AAGATATCTGCCTTTATAAAGGCCGCCAAAGGGCTTAGATAG
Transcript >OphauG2|3830
ATGGCATCAACAGCAGCAGGCCTCGTAGATTACTCGCCGCACCAACCTGATGCCTCTCCCCGCGTGCCAACCGCG
TCCAATCTGATTCTCATTGACAACTATGACTCCTTCACCTGGAACATATACCAGTATCTGGTTCTCGAAGGCGCC
ACGGTGCACGTCTTCAGAAATGACCAGATCACGCTGGAGGAACTCGTGGAGAAGAAGCCGACGCAGCTCATCATC
AGTCCGGGGCCTGGGCACCCTGCCACCGATTCAGGCATCAGCCGCGATGTCATTAGGCATTTTGCGGGCAAGGTT
CCCATTTTTGGGGTCTGCATGGGACTACAGTGCATGTTTGACGTCTATGGCGGCGAGGTCAGGTCGGCGGGAGAA
TGGCTCCATGGCAAAACATCGCCCCTGACTCACGACTCCAAGGGCGTCTTTGCCAACCTGGAGCAGCAAATTCCC
GTCACCAGATATCATTCTCTGGCTGGGACGCACGTGACGCTGCCCGAGTGCCTCGAGATATCGTCGTGGGTGGCC
AATCCTGACGGCTCACGCGGCATCATTCAGGGCATTCGCCACAAAGTCTTGACCCTGGAAGGCGTCCAGTTCCAT
CCCGAGAGCATTCTCACCGCCCACGGCCGCAAGATGATTAAGAATTTCTTGCTTATGCAGGGCGGCACCTGGGCT
GAAAACGAGCGTCTGCAAGCCGAGCGCGCTGCCTCTGCACCGCCAACGCCCATAAAGCCCAAGGGCAACAATATT
CTGCAGACAATATATGCCCATCGCAAAGCTGCCGTCGCCGTCCAGCGACAAATTCCGTCGCAAAGAATGGAGGAC
ATGCAAGCTGCCCATCATCTTGACGCTGCTCCTCCTCTTGTTCCCTTTGTCAGCCGTTTGCGCCAGTCGCCCTTT
GACGTGGCTCTCATGGCCGAAATCAAACGTGCCTCGCCGTCAAAAGGCATCTTTGCCCTTGATATCAATGCGCCG
ACCCAGGCACGCAAGTATGCCCTGGCAGGAGCCAGTGTCATCTCGGTCCTGACGGAGCCCGAGTGGTTCAAGGGA
AGTATCCAGGACCTGAGGGCAGTGAGACAGGTGCTGGACGGCATGCCAAACAGACCTGCCATCCTGCGAAAGGAC
TTCATCTTTGACGAGTATCAGATTCTAGAGGCCAGATTGGAAGGGGCAGACAGCGTTCTGCTCATCGTCAAGATG
CTCGACCAAGCCTTGCTTCAGCGCCTCTATGACTACTCCGTCTCCCTGGGCATGGAGCCGCTGGTTGAAGTCCAG
AATGCCCAGGAAATGATAATTGCTGTCAACCTTGGAGCCAAGGTGATTGGAGTCAACAACCGCAACCTCGAGAGC
TTCGAGGTGGATCTCGACACGACGGGGCGCCTACGCAGCATGGTGCCTGAACAAACCCTCATATGTGCTCTCAGC
GGCATCAACACCCACGACGATGTGCTTATGAACAAAAGGGACGGAGTCAATGCCGTGCTTGTTGGAGAGGCAATT
ATGCGTGCTCCGGATGCCAGCGTCTTCATTAGCGAGCTCTGCTCAGGCTCCAAGCCGCCGGCGAAAGCGCCGTCT
CCCTCGTCTCTCATGGTCAAGATTTGTGGCACGCGCAGTCTTGAAGCTGCACAGCGGGCTATGGAGGCGGGGGCT
GACTTTGTCGGCATCTGCTTGGTGCCCGGTGCCAAACGCTGTATATCCCACGATGCAGCATTGGCCATTTCCAAA
GCCCTTCGTTCGTTTGCTGGCTCGCAGGCCCCACGGGAGCAACCGGCCAAACTGCCAGTCAATACTGCCATGGAC
TTTTTCGCTTCGACTGAGGAACGATTGGGCAGTGGCCGCCCACGCCTTGTGGGCATTTTCCAAAACCAGCCTCTC
AGTCATGTGCTGGATAAGCAGAGGCAGTATAACCTTGACATGGTGCAGCTTCATGGCGACGAGCCCATTGAATGG
GCCAGGCTGATTCCTGTCCCCGTAATCCGCTGTTTCAAGCCTGGGCAGGTTGGCATTGGCAAGCGCGGCTACCAT
ATACTTCCCTTGCTGGACTCGGGCTCGGGCTCGGGCAAGATGCTCGACGTGTCGAATGTCAAGGCTGTGCTGCAG
CAGGATCCAGATCTCAGGGTGTTTCTAGCTGGTGGCTTGAATCCAGATAATGTAGCGTCAGCGGTTGAAGCCCTG
GGCGAGCTGGGTCATCGAGTGCTGGGTGTTGATGTGAGCAGTGGAGTAGAGGTGGATGGGAAGCAAGACTTGGAC
AAGATATCTGCCTTTATAAAGGCCGCCAAAGGGCTTAGATAG
Gene >OphauG2|3830
ATGGCATCAACAGCAGCAGGCCTCGTAGATTACTCGCCGCACCAACCTGATGCCTCTCCCCGCGTGCCAACCGCG
TCCAATCTGATTCTCATTGACAACTATGACTCCTTCACCTGGAACATATACCAGTATCTGGTTCTCGAAGGCGCC
ACGGTGCACGTCTTCAGAAATGACCAGATCACGCTGGAGGAACTCGTGGAGAAGAAGCCGACGCAGCTCATCATC
AGTCCGGGGCCTGGGCACCCTGCCACCGATTCAGGCATCAGCCGCGATGTCATTAGGCATTTTGCGGGCAAGGTT
CCCATTTTTGGGGTCTGCATGGGACTGTGAGTGATGCACAAGGCCCATTTTGCTCCCAGGCTTGATGCAAGGCTG
GCTTGATGCAAGGCTTGTTCCAAGGCTTCTTCCAAGACTTGTTCCAAGGCTTGTTCCGAGACCAGTCCCAAGGCT
ACATACATACATAGTGTCACAAATGCTCACTCGTCCCTCCCAGACAGTGCATGTTTGACGTCTATGGCGGCGAGG
TCAGGTCGGCGGGAGAATGGCTCCATGGCAAAACATCGCCCCTGACTCACGACTCCAAGGGCGTCTTTGCCAACC
TGGAGCAGCAAATTCCCGTCACCAGATATCATTCTCTGGCTGGGACGCACGTGACGCTGCCCGAGTGCCTCGAGA
TATCGTCGTGGGTGGCCAATCCTGACGGCTCACGCGGCATCATTCAGGGCATTCGCCACAAAGTCTTGACCCTGG
AAGGCGTCCAGTTCCATCCCGAGAGCATTCTCACCGCCCACGGCCGCAAGATGATTAAGAATTTCTTGCTTATGC
AGGGCGGCACCTGGGCTGAAAACGAGCGTCTGCAAGCCGAGCGCGCTGCCTCTGCACCGCCAACGCCCATAAAGC
CCAAGGGCAACAATATTCTGCAGACAATATATGCCCATCGCAAAGCTGCCGTCGCCGTCCAGCGACAAATTCCGT
CGCAAAGAATGGAGGACATGCAAGCTGCCCATCATCTTGACGCTGCTCCTCCTCTTGTTCCCTTTGTCAGCCGTT
TGCGCCAGTCGCCCTTTGACGTGGCTCTCATGGCCGAAATCAAACGTGCCTCGCCGTCAAAAGGCATCTTTGCCC
TTGATATCAATGCGCCGACCCAGGCACGCAAGTATGCCCTGGCAGGAGCCAGTGTCATCTCGGTCCTGACGGAGC
CCGAGTGGTTCAAGGGAAGTATCCAGGACCTGAGGGCAGTGAGACAGGTGCTGGACGGCATGCCAAACAGACCTG
CCATCCTGCGAAAGGACTTCATCTTTGACGAGTATCAGATTCTAGAGGCCAGATTGGAAGGGGCAGACAGCGTTC
TGCTCATCGTCAAGATGCTCGACCAAGCCTTGCTTCAGCGCCTCTATGACTACTCCGTCTCCCTGGGCATGGAGC
CGCTGGTTGAAGTCCAGAATGCCCAGGAAATGATAATTGCTGTCAACCTTGGAGCCAAGGTGATTGGAGTCAACA
ACCGCAACCTCGAGAGCTTCGAGGTGGATCTCGACACGACGGGGCGCCTACGCAGCATGGTGCCTGAACAAACCC
TCATATGTGCTCTCAGCGGCATCAACACCCACGACGATGTGCTTATGAACAAAAGGGACGGAGTCAATGCCGTGC
TTGTTGGAGAGGCAATTATGCGTGCTCCGGATGCCAGCGTCTTCATTAGCGAGCTCTGCTCAGGCTCCAAGCCGC
CGGCGAAAGCGCCGTCTCCCTCGTCTCTCATGGTCAAGATTTGTGGCACGCGCAGTCTTGAAGCTGCACAGCGGG
CTATGGAGGCGGGGGCTGACTTTGTCGGCATCTGCTTGGTGCCCGGTGCCAAACGCTGTATATCCCACGATGCAG
CATTGGCCATTTCCAAAGCCCTTCGTTCGTTTGCTGGCTCGCAGGCCCCACGGGAGCAACCGGCCAAACTGCCAG
TCAATACTGCCATGGACTTTTTCGCTTCGACTGAGGAACGATTGGGCAGTGGCCGCCCACGCCTTGTGGGCATTT
TCCAAAACCAGCCTCTCAGTCATGTGCTGGATAAGCAGAGGCAGTATAACCTTGACATGGTGCAGCTTCATGGCG
ACGAGCCCATTGAATGGGCCAGGCTGATTCCTGTCCCCGTAATCCGCTGTTTCAAGCCTGGGCAGGTTGGCATTG
GCAAGCGCGGCTACCATATACTTCCCTTGCTGGACTCGGGCTCGGGCTCGGGCAAGATGCTCGACGTGTCGAATG
TCAAGGCTGTGCTGCAGCAGGATCCAGATCTCAGGGTGTTTCTAGCTGGTGGCTTGAATCCAGATAATGTAGCGT
CAGCGGTTGAAGCCCTGGGCGAGCTGGGTCATCGAGTGCTGGGTGTTGATGTGAGCAGTGGAGTAGAGGTGGATG
GGAAGCAAGACTTGGACAAGATATCTGCCTTTATAAAGGCCGCCAAAGGGCTTAGATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail