Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|3827
Gene name
LocationContig_3:78505..79058
Strand+
Gene length (bp)553
Transcript length (bp)498
Coding sequence length (bp)498
Protein length (aa) 166

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08312 cwf21 cwf21 domain 4.3E-17 54 97

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4IB70|CWC21_GIBZE Pre-mRNA-splicing factor CWC21 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=CWC21 PE=3 SV=1 1 158 2.0E-81
sp|Q7RYH7|CWC21_NEUCR Pre-mRNA-splicing factor cwc-21 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cwc-21 PE=3 SV=1 1 158 2.0E-62
sp|P0CM94|CWC21_CRYNJ Pre-mRNA-splicing factor CWC21 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CWC21 PE=3 SV=1 1 156 1.0E-33
sp|P0CM95|CWC21_CRYNB Pre-mRNA-splicing factor CWC21 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=CWC21 PE=3 SV=1 1 156 1.0E-33
sp|Q4P0G6|CWC21_USTMA Pre-mRNA-splicing factor CWC21 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CWC21 PE=3 SV=1 1 97 3.0E-18
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4IB70|CWC21_GIBZE Pre-mRNA-splicing factor CWC21 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=CWC21 PE=3 SV=1 1 158 2.0E-81
sp|Q7RYH7|CWC21_NEUCR Pre-mRNA-splicing factor cwc-21 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cwc-21 PE=3 SV=1 1 158 2.0E-62
sp|P0CM94|CWC21_CRYNJ Pre-mRNA-splicing factor CWC21 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CWC21 PE=3 SV=1 1 156 1.0E-33
sp|P0CM95|CWC21_CRYNB Pre-mRNA-splicing factor CWC21 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=CWC21 PE=3 SV=1 1 156 1.0E-33
sp|Q4P0G6|CWC21_USTMA Pre-mRNA-splicing factor CWC21 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CWC21 PE=3 SV=1 1 97 3.0E-18
sp|Q8BTI8|SRRM2_MOUSE Serine/arginine repetitive matrix protein 2 OS=Mus musculus GN=Srrm2 PE=1 SV=3 1 146 6.0E-15
sp|Q751G9|CWC21_ASHGO Pre-mRNA-splicing factor CWC21 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=CWC21 PE=3 SV=1 1 98 2.0E-14
sp|Q9UQ35|SRRM2_HUMAN Serine/arginine repetitive matrix protein 2 OS=Homo sapiens GN=SRRM2 PE=1 SV=2 1 146 2.0E-13
sp|Q6BWB8|CWC21_DEBHA Pre-mRNA-splicing factor CWC21 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=CWC21 PE=3 SV=1 1 94 3.0E-13
sp|O14161|CWC21_SCHPO Pre-mRNA-splicing factor cwf21 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cwf21 PE=1 SV=2 1 146 1.0E-10
sp|Q6CVR3|CWC21_KLULA Pre-mRNA-splicing factor CWC21 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=CWC21 PE=3 SV=2 1 94 6.0E-10
sp|Q6FRM6|CWC21_CANGA Pre-mRNA-splicing factor CWC21 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=CWC21 PE=3 SV=1 1 97 2.0E-09
sp|Q5AP89|CWC21_CANAL Pre-mRNA-splicing factor CWC21 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CWC21 PE=3 SV=1 1 95 6.0E-09
sp|Q6C0M9|CWC21_YARLI Pre-mRNA-splicing factor CWC21 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=CWC21 PE=3 SV=1 1 142 7.0E-07
sp|Q4WDD0|CWC21_ASPFU Pre-mRNA-splicing factor cwc21 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=cwc21 PE=3 SV=1 108 143 3.0E-06
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1094
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3827 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|6764
Ophiocordyceps camponoti-floridani Ophcf2|01284
Ophiocordyceps camponoti-rufipedis Ophun1|2330
Ophiocordyceps kimflemingae Ophio5|1052
Ophiocordyceps subramaniannii Hirsu2|10103

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|3827
MSDNVGLSTPRGSGTSGYVQRNLAHMKPRDYGAPYPKDLDSLRHKRPQPDEGILEHNRKRQIEVKVFELREELED
EEVAEEEIERRCDELRQKLTAESEAGPKSGSGRRVFKEHQVHEMADAKIKESERLRKALNISQDYEEGSHWRRQE
ERLRSALEDGEDLKK*
Coding >OphauG2|3827
ATGTCGGACAATGTTGGCCTGTCGACGCCGCGTGGCAGCGGCACTTCGGGCTATGTGCAGCGCAATCTTGCCCAC
ATGAAGCCCCGTGATTACGGCGCGCCATACCCCAAGGACCTGGATAGCCTGCGACATAAGCGGCCGCAGCCCGAT
GAAGGGATCCTCGAACACAACCGCAAGCGCCAGATCGAGGTCAAGGTGTTTGAGCTGCGCGAAGAGCTCGAGGAT
GAAGAGGTTGCAGAGGAGGAGATCGAGCGGCGGTGCGACGAACTGCGTCAAAAGCTGACGGCCGAGTCCGAGGCA
GGCCCAAAGAGCGGCAGCGGGCGCAGAGTTTTCAAGGAGCATCAGGTGCATGAGATGGCGGATGCCAAAATCAAG
GAGAGCGAACGGCTGCGCAAGGCGCTCAACATCAGCCAAGACTATGAGGAAGGCAGTCATTGGCGTCGGCAGGAG
GAGAGACTGCGCAGTGCTCTCGAGGATGGCGAGGATTTGAAGAAATAG
Transcript >OphauG2|3827
ATGTCGGACAATGTTGGCCTGTCGACGCCGCGTGGCAGCGGCACTTCGGGCTATGTGCAGCGCAATCTTGCCCAC
ATGAAGCCCCGTGATTACGGCGCGCCATACCCCAAGGACCTGGATAGCCTGCGACATAAGCGGCCGCAGCCCGAT
GAAGGGATCCTCGAACACAACCGCAAGCGCCAGATCGAGGTCAAGGTGTTTGAGCTGCGCGAAGAGCTCGAGGAT
GAAGAGGTTGCAGAGGAGGAGATCGAGCGGCGGTGCGACGAACTGCGTCAAAAGCTGACGGCCGAGTCCGAGGCA
GGCCCAAAGAGCGGCAGCGGGCGCAGAGTTTTCAAGGAGCATCAGGTGCATGAGATGGCGGATGCCAAAATCAAG
GAGAGCGAACGGCTGCGCAAGGCGCTCAACATCAGCCAAGACTATGAGGAAGGCAGTCATTGGCGTCGGCAGGAG
GAGAGACTGCGCAGTGCTCTCGAGGATGGCGAGGATTTGAAGAAATAG
Gene >OphauG2|3827
ATGTCGGACAATGTTGGCCTGTCGACGCCGCGTGGCAGCGGCACTTCGGGCTATGTGCAGCGCAATCTTGCCCAC
ATGAAGCCCCGTGATTACGGCGCGCCATACCCCAAGGACCTGGATAGCCTGCGACATAAGCGGCCGCAGCCCGAT
GAAGGGATCCTCGAACACAACCGCAAGCGCCAGATCGAGGTCAAGGTGTTTGAGCTGCGCGAAGAGCTCGAGGAT
GAAGAGTGCGTTTTGGCCGGGGATGTGCAAGAGCTGCCTTTGCTGACGTTGGAGGCTCAGGGTTGCAGAGGAGGA
GATCGAGCGGCGGTGCGACGAACTGCGTCAAAAGCTGACGGCCGAGTCCGAGGCAGGCCCAAAGAGCGGCAGCGG
GCGCAGAGTTTTCAAGGAGCATCAGGTGCATGAGATGGCGGATGCCAAAATCAAGGAGAGCGAACGGCTGCGCAA
GGCGCTCAACATCAGCCAAGACTATGAGGAAGGCAGTCATTGGCGTCGGCAGGAGGAGAGACTGCGCAGTGCTCT
CGAGGATGGCGAGGATTTGAAGAAATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail