Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|3818
Gene name
LocationContig_3:52662..53325
Strand+
Gene length (bp)663
Transcript length (bp)591
Coding sequence length (bp)591
Protein length (aa) 197

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|A4FSH5|PHIA_ASPFM Cell wall protein phiA OS=Neosartorya fumigata GN=phiA PE=1 SV=1 37 194 7.0E-57
sp|B0Y004|PHIA_ASPFC Cell wall protein phiA OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=phiA PE=3 SV=1 37 194 7.0E-57
sp|Q5ATP7|PHIA_EMENI Cell wall protein phiA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=phiA PE=2 SV=1 31 193 1.0E-51
sp|A2R2S8|PHIA_ASPNC Cell wall protein phiA OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=phiA PE=2 SV=1 35 193 5.0E-48
sp|D4AV66|PHIA_ARTBC Cell wall protein phiA OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=phiA PE=1 SV=1 1 193 2.0E-32

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|3818
MKLSSVLASVAAAGSALAAPQGDYKPPPSQPQNPQTFGIMSLHSASPIHFGQFSAANGNLYIYLANQNATCDRPN
VQWATFYIKDGSMYLYSKDKPVQEIYVDRSGMGQGKTGYTTGTYIPAPRNSERKTWTIDQTGDLTFNGAGLLACP
STTDNSWSIWVLSGVSPPAGLKGCLGMVARTINITDPASCEYTKPW*
Coding >OphauG2|3818
ATGAAGCTGTCAAGTGTCCTGGCCTCTGTCGCCGCGGCGGGCTCTGCTTTGGCTGCACCACAGGGCGATTACAAG
CCGCCACCAAGCCAACCACAGAACCCCCAGACCTTTGGCATCATGTCTCTGCACTCTGCCAGCCCAATTCACTTT
GGCCAGTTTAGTGCTGCCAATGGGAACCTTTACATCTACCTCGCCAACCAAAACGCCACCTGTGACCGCCCCAAC
GTTCAATGGGCCACCTTTTACATCAAGGACGGTAGCATGTATCTCTACTCCAAGGATAAGCCGGTTCAAGAGATC
TATGTGGACCGTTCTGGCATGGGTCAAGGAAAGACGGGCTACACCACTGGGACTTATATTCCGGCGCCGCGCAAC
TCGGAGCGCAAGACTTGGACCATTGACCAGACGGGCGACCTCACTTTCAACGGGGCCGGTCTGCTGGCCTGTCCG
TCCACCACTGACAACTCGTGGAGCATCTGGGTCTTGAGTGGCGTCTCGCCGCCTGCTGGGTTGAAGGGATGTCTG
GGCATGGTGGCCCGAACCATTAATATTACCGACCCTGCGAGCTGCGAGTATACCAAGCCTTGGTAG
Transcript >OphauG2|3818
ATGAAGCTGTCAAGTGTCCTGGCCTCTGTCGCCGCGGCGGGCTCTGCTTTGGCTGCACCACAGGGCGATTACAAG
CCGCCACCAAGCCAACCACAGAACCCCCAGACCTTTGGCATCATGTCTCTGCACTCTGCCAGCCCAATTCACTTT
GGCCAGTTTAGTGCTGCCAATGGGAACCTTTACATCTACCTCGCCAACCAAAACGCCACCTGTGACCGCCCCAAC
GTTCAATGGGCCACCTTTTACATCAAGGACGGTAGCATGTATCTCTACTCCAAGGATAAGCCGGTTCAAGAGATC
TATGTGGACCGTTCTGGCATGGGTCAAGGAAAGACGGGCTACACCACTGGGACTTATATTCCGGCGCCGCGCAAC
TCGGAGCGCAAGACTTGGACCATTGACCAGACGGGCGACCTCACTTTCAACGGGGCCGGTCTGCTGGCCTGTCCG
TCCACCACTGACAACTCGTGGAGCATCTGGGTCTTGAGTGGCGTCTCGCCGCCTGCTGGGTTGAAGGGATGTCTG
GGCATGGTGGCCCGAACCATTAATATTACCGACCCTGCGAGCTGCGAGTATACCAAGCCTTGGTAG
Gene >OphauG2|3818
ATGAAGCTGTCAAGTGTCCTGGCCTCTGTCGCCGCGGCGGGCTCTGCTTTGGCTGCACCACAGGGCGATTACAAG
CCGCCACCAAGCCAACCACAGAACCCCCAGACCTTTGGCATCATGTCTCTGCACTCTGCCAGCCCAATTCACTTT
GGCCAGTTTAGTGCTGCCAATGGGAACCTTTACATCTACCTCGCCAACCAAAACGCCACCTGTGACCGCCCCAAC
GTTCAATGGGCCACCTTTTACATCAAGGACGGTAGCATGTATCTCTACTCCAAGGATAAGCCGGTTCAAGAGATC
TATGTGGACCGTTCTGGCATGGGTAAGTATGGCAATGCTGCATCTCCTCTGTATTCGCGTGGCGTGGCGGGCGCT
GACTGGCGGCATGTTGCAGGTCAAGGAAAGACGGGCTACACCACTGGGACTTATATTCCGGCGCCGCGCAACTCG
GAGCGCAAGACTTGGACCATTGACCAGACGGGCGACCTCACTTTCAACGGGGCCGGTCTGCTGGCCTGTCCGTCC
ACCACTGACAACTCGTGGAGCATCTGGGTCTTGAGTGGCGTCTCGCCGCCTGCTGGGTTGAAGGGATGTCTGGGC
ATGGTGGCCCGAACCATTAATATTACCGACCCTGCGAGCTGCGAGTATACCAAGCCTTGGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail