Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|3814
Gene name
LocationContig_3:37163..38837
Strand+
Gene length (bp)1674
Transcript length (bp)1593
Coding sequence length (bp)1593
Protein length (aa) 531

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00899 ThiF ThiF family 2.9E-25 103 431

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q06624|RHC31_YEAST DNA damage tolerance protein RHC31 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AOS1 PE=1 SV=1 90 441 6.0E-66
sp|A2VE14|SAE1_BOVIN SUMO-activating enzyme subunit 1 OS=Bos taurus GN=SAE1 PE=2 SV=1 95 443 1.0E-42
sp|P79064|RAD31_SCHPO DNA damage tolerance protein rad31 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rad31 PE=4 SV=1 95 441 2.0E-42
sp|Q6AXQ0|SAE1_RAT SUMO-activating enzyme subunit 1 OS=Rattus norvegicus GN=Sae1 PE=2 SV=1 101 444 9.0E-42
sp|Q8JGT5|SAE1_XENLA SUMO-activating enzyme subunit 1 OS=Xenopus laevis GN=sae1 PE=2 SV=1 95 431 1.0E-41
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q06624|RHC31_YEAST DNA damage tolerance protein RHC31 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AOS1 PE=1 SV=1 90 441 6.0E-66
sp|A2VE14|SAE1_BOVIN SUMO-activating enzyme subunit 1 OS=Bos taurus GN=SAE1 PE=2 SV=1 95 443 1.0E-42
sp|P79064|RAD31_SCHPO DNA damage tolerance protein rad31 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rad31 PE=4 SV=1 95 441 2.0E-42
sp|Q6AXQ0|SAE1_RAT SUMO-activating enzyme subunit 1 OS=Rattus norvegicus GN=Sae1 PE=2 SV=1 101 444 9.0E-42
sp|Q8JGT5|SAE1_XENLA SUMO-activating enzyme subunit 1 OS=Xenopus laevis GN=sae1 PE=2 SV=1 95 431 1.0E-41
sp|Q5NVN7|SAE1_PONAB SUMO-activating enzyme subunit 1 OS=Pongo abelii GN=SAE1 PE=2 SV=2 95 444 2.0E-41
sp|Q9UBE0|SAE1_HUMAN SUMO-activating enzyme subunit 1 OS=Homo sapiens GN=SAE1 PE=1 SV=1 95 444 2.0E-41
sp|Q9R1T2|SAE1_MOUSE SUMO-activating enzyme subunit 1 OS=Mus musculus GN=Sae1 PE=1 SV=1 101 444 5.0E-41
sp|Q28DS0|SAE1_XENTR SUMO-activating enzyme subunit 1 OS=Xenopus tropicalis GN=sae1 PE=2 SV=1 95 431 6.0E-40
sp|Q6IQS6|SAE1_DANRE SUMO-activating enzyme subunit 1 OS=Danio rerio GN=sae1 PE=2 SV=1 95 431 6.0E-37
sp|Q8VY78|SAE1A_ARATH SUMO-activating enzyme subunit 1A OS=Arabidopsis thaliana GN=SAE1A PE=1 SV=1 93 438 1.0E-28
sp|P0DI13|SA1B2_ARATH SUMO-activating enzyme subunit 1B-2 OS=Arabidopsis thaliana GN=SAE1B-2 PE=1 SV=1 94 432 8.0E-28
sp|P0DI12|SA1B1_ARATH SUMO-activating enzyme subunit 1B-1 OS=Arabidopsis thaliana GN=SAE1B-1 PE=1 SV=1 94 432 8.0E-28
sp|Q54WI4|SAE1_DICDI SUMO-activating enzyme subunit 1 OS=Dictyostelium discoideum GN=sae1 PE=3 SV=1 102 431 1.0E-27
sp|Q17820|SAE1_CAEEL SUMO-activating enzyme subunit aos-1 OS=Caenorhabditis elegans GN=aos-1 PE=3 SV=1 94 431 1.0E-23
sp|P42744|ULA1_ARATH NEDD8-activating enzyme E1 regulatory subunit OS=Arabidopsis thaliana GN=AXR1 PE=1 SV=1 103 258 3.0E-21
sp|Q9VTE9|ULA1_DROME Nedd8-activating enzyme E1 regulatory subunit OS=Drosophila melanogaster GN=APP-BP1 PE=1 SV=1 97 268 7.0E-21
sp|Q5ZIE6|ULA1_CHICK NEDD8-activating enzyme E1 regulatory subunit OS=Gallus gallus GN=NAE1 PE=2 SV=1 103 268 7.0E-19
sp|Q9Z1A5|ULA1_RAT NEDD8-activating enzyme E1 regulatory subunit OS=Rattus norvegicus GN=Nae1 PE=1 SV=1 103 268 9.0E-19
sp|Q54JM3|ULA1_DICDI NEDD8-activating enzyme E1 regulatory subunit OS=Dictyostelium discoideum GN=nae1 PE=3 SV=1 96 268 2.0E-18
sp|Q8VBW6|ULA1_MOUSE NEDD8-activating enzyme E1 regulatory subunit OS=Mus musculus GN=Nae1 PE=1 SV=1 103 268 2.0E-18
sp|Q7SXP2|ULA1_DANRE NEDD8-activating enzyme E1 regulatory subunit OS=Danio rerio GN=nae1 PE=2 SV=2 103 268 2.0E-18
sp|P52495|UBA1_CANAW Ubiquitin-activating enzyme E1 1 OS=Candida albicans (strain WO-1) GN=UBA1 PE=3 SV=2 99 264 3.0E-18
sp|Q13564|ULA1_HUMAN NEDD8-activating enzyme E1 regulatory subunit OS=Homo sapiens GN=NAE1 PE=1 SV=1 103 268 3.0E-18
sp|Q6NTW6|ULA1_XENLA NEDD8-activating enzyme E1 regulatory subunit OS=Xenopus laevis GN=nae1 PE=2 SV=1 103 268 4.0E-17
sp|P22515|UBA1_YEAST Ubiquitin-activating enzyme E1 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UBA1 PE=1 SV=2 99 287 7.0E-17
sp|P41226|UBA7_HUMAN Ubiquitin-like modifier-activating enzyme 7 OS=Homo sapiens GN=UBA7 PE=1 SV=2 99 268 2.0E-16
sp|Q18217|ULA1_CAEEL NEDD8-activating enzyme E1 regulatory subunit OS=Caenorhabditis elegans GN=ula-1 PE=3 SV=2 103 258 7.0E-16
sp|O94609|UBA1_SCHPO Ubiquitin-activating enzyme E1 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ptr3 PE=1 SV=1 99 265 9.0E-16
sp|Q29504|UBA1_RABIT Ubiquitin-like modifier-activating enzyme 1 OS=Oryctolagus cuniculus GN=UBA1 PE=1 SV=1 64 258 5.0E-14
sp|P22314|UBA1_HUMAN Ubiquitin-like modifier-activating enzyme 1 OS=Homo sapiens GN=UBA1 PE=1 SV=3 64 258 8.0E-14
sp|Q02053|UBA1_MOUSE Ubiquitin-like modifier-activating enzyme 1 OS=Mus musculus GN=Uba1 PE=1 SV=1 64 258 1.0E-13
sp|Q4R3L6|ULA1_MACFA NEDD8-activating enzyme E1 regulatory subunit OS=Macaca fascicularis GN=NAE1 PE=2 SV=1 103 268 2.0E-13
sp|A3KMV5|UBA1_BOVIN Ubiquitin-like modifier-activating enzyme 1 OS=Bos taurus GN=UBA1 PE=2 SV=1 64 258 4.0E-13
sp|Q9UT93|ULA1_SCHPO NEDD8-activating enzyme E1 regulatory subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=uba5 PE=3 SV=2 103 220 8.0E-13
sp|P20973|UBE11_WHEAT Ubiquitin-activating enzyme E1 1 OS=Triticum aestivum GN=UBA1 PE=1 SV=1 99 255 1.0E-12
sp|P31251|UBE12_WHEAT Ubiquitin-activating enzyme E1 2 OS=Triticum aestivum GN=UBA2 PE=2 SV=1 99 255 1.0E-12
sp|Q5U300|UBA1_RAT Ubiquitin-like modifier-activating enzyme 1 OS=Rattus norvegicus GN=Uba1 PE=1 SV=1 64 258 2.0E-12
sp|A0AVT1|UBA6_HUMAN Ubiquitin-like modifier-activating enzyme 6 OS=Homo sapiens GN=UBA6 PE=1 SV=1 61 255 2.0E-12
sp|P31254|UBA1Y_MOUSE Ubiquitin-like modifier-activating enzyme 1 Y OS=Mus musculus GN=Uba1y PE=1 SV=2 99 257 2.0E-12
sp|P92974|UBE12_ARATH Ubiquitin-activating enzyme E1 2 OS=Arabidopsis thaliana GN=UBA2 PE=1 SV=1 82 265 5.0E-12
sp|Q8C7R4|UBA6_MOUSE Ubiquitin-like modifier-activating enzyme 6 OS=Mus musculus GN=Uba6 PE=1 SV=1 92 255 4.0E-11
sp|P93028|UBE11_ARATH Ubiquitin-activating enzyme E1 1 OS=Arabidopsis thaliana GN=UBA1 PE=1 SV=1 93 255 7.0E-11
sp|Q55C16|UBA1_DICDI Ubiquitin-like modifier-activating enzyme 1 OS=Dictyostelium discoideum GN=uba1 PE=3 SV=1 89 268 8.0E-11
sp|B4HYP0|MOCS3_DROSE Adenylyltransferase and sulfurtransferase MOCS3 OS=Drosophila sechellia GN=GM17034 PE=3 SV=1 78 235 7.0E-10
sp|B4JBC4|MOCS3_DROGR Adenylyltransferase and sulfurtransferase MOCS3 OS=Drosophila grimshawi GN=GH10959 PE=3 SV=1 83 236 2.0E-09
sp|B4N7R4|MOCS3_DROWI Adenylyltransferase and sulfurtransferase MOCS3 OS=Drosophila willistoni GN=GK18675 PE=3 SV=1 94 237 3.0E-09
sp|P31252|UBE13_WHEAT Ubiquitin-activating enzyme E1 3 OS=Triticum aestivum GN=UBA3 PE=1 SV=1 93 255 4.0E-09
sp|P20973|UBE11_WHEAT Ubiquitin-activating enzyme E1 1 OS=Triticum aestivum GN=UBA1 PE=1 SV=1 103 198 1.0E-08
sp|P31251|UBE12_WHEAT Ubiquitin-activating enzyme E1 2 OS=Triticum aestivum GN=UBA2 PE=2 SV=1 103 198 2.0E-08
sp|B4KI53|MOCS3_DROMO Adenylyltransferase and sulfurtransferase MOCS3 OS=Drosophila mojavensis GN=GI10453 PE=3 SV=1 91 236 2.0E-08
sp|Q12059|ULA1_YEAST NEDD8-activating enzyme E1 regulatory subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ULA1 PE=1 SV=1 103 266 5.0E-08
sp|P92974|UBE12_ARATH Ubiquitin-activating enzyme E1 2 OS=Arabidopsis thaliana GN=UBA2 PE=1 SV=1 103 209 8.0E-08
sp|B4GKQ3|MOCS3_DROPE Adenylyltransferase and sulfurtransferase MOCS3 OS=Drosophila persimilis GN=GL26133 PE=3 SV=1 73 250 2.0E-07
sp|B5DS72|MOC31_DROPS Adenylyltransferase and sulfurtransferase MOCS3-1 OS=Drosophila pseudoobscura pseudoobscura GN=GA24966 PE=3 SV=1 73 250 2.0E-07
sp|Q29PG5|MOC32_DROPS Adenylyltransferase and sulfurtransferase MOCS3-2 OS=Drosophila pseudoobscura pseudoobscura GN=GA12041 PE=3 SV=1 73 250 2.0E-07
sp|Q9VLJ8|MOCS3_DROME Adenylyltransferase and sulfurtransferase MOCS3 OS=Drosophila melanogaster GN=CG13090 PE=1 SV=1 71 236 2.0E-07
sp|P31252|UBE13_WHEAT Ubiquitin-activating enzyme E1 3 OS=Triticum aestivum GN=UBA3 PE=1 SV=1 103 216 3.0E-07
sp|B3MLX7|MOCS3_DROAN Adenylyltransferase and sulfurtransferase MOCS3 OS=Drosophila ananassae GN=GF15533 PE=3 SV=1 85 216 3.0E-07
sp|P93028|UBE11_ARATH Ubiquitin-activating enzyme E1 1 OS=Arabidopsis thaliana GN=UBA1 PE=1 SV=1 103 209 6.0E-07
sp|P12282|MOEB_ECOLI Molybdopterin-synthase adenylyltransferase OS=Escherichia coli (strain K12) GN=moeB PE=1 SV=1 94 194 5.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 38 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|3814
MTPGSHDVAEDEGAAANSHSDKHSDKHSDKHSINHTINHTNNHTNKPPMAHHQDAAMAASMMAPHPLAQQQPASA
TDANTLMAPNGGAPVHTQQVSADDVALYDRQIRLWGMAAQASIQRANILIITMRALANEVAKNLVLAGIGSLTLL
DDAVATEADLGAQFLLADVANVVGQKRAQAASLALTKLNPRVRIHVDADSVANKRPNYFAAFDVVIATDLDPDSF
NIINTATRLNNKAFYAAGTHGLYGFIFLDLIEHDYVIERDPSNVPARPGTQETRTRSILDIKTRCEGSKTVESVT
KRELYSTWFLASDLAVLPEEYTKSRRRLRAVTPVLSCLRALWEFKQLCGPHAKPSTRDDLKLFTQLATQKHKRLG
LPSETLSSAFLRSFLQNLGAEMAPVTAILGGQLAQDVINVLGHSQQPIQNMVVFDGDRLEAAMYPLHPEGSLGAS
LLSLGSATLTDPDALAAQNALLDSLAGPAVLPGPTAMPGALGSAVPLAMGNHVAVALPFAAEAPVPSASDHHGTE
QLDAS*
Coding >OphauG2|3814
ATGACGCCGGGAAGCCACGACGTTGCAGAAGACGAGGGCGCTGCCGCCAACAGCCATAGCGACAAGCACAGCGAC
AAGCATAGCGACAAGCATAGCATCAACCACACCATCAACCACACCAACAACCACACCAACAAGCCCCCCATGGCT
CATCACCAAGACGCCGCCATGGCTGCTTCCATGATGGCTCCCCATCCCCTCGCCCAGCAGCAGCCCGCGTCCGCC
ACTGATGCAAACACGCTCATGGCGCCAAACGGCGGCGCGCCGGTGCACACGCAACAAGTCTCTGCAGACGATGTT
GCGCTCTATGACCGCCAGATCCGGCTCTGGGGAATGGCTGCTCAGGCCAGCATTCAAAGGGCAAATATCCTCATC
ATCACTATGCGCGCCCTGGCAAACGAAGTGGCCAAGAATCTCGTGCTGGCTGGCATCGGCTCCTTGACCCTGCTC
GACGACGCTGTTGCCACCGAGGCCGACTTGGGCGCCCAGTTCTTGCTGGCCGATGTGGCCAACGTGGTGGGCCAG
AAGCGCGCCCAGGCCGCCAGCCTTGCCCTCACCAAGCTCAACCCGCGCGTGCGCATCCACGTCGACGCCGACAGC
GTGGCAAACAAGCGGCCCAACTACTTTGCCGCCTTTGACGTGGTGATTGCCACGGACCTGGACCCCGACTCCTTC
AACATCATCAACACGGCCACCCGCCTCAACAACAAGGCCTTTTACGCCGCCGGCACCCATGGGCTCTACGGCTTC
ATCTTTCTCGATCTGATTGAGCACGACTACGTCATTGAGCGCGACCCTTCCAACGTGCCCGCCCGCCCCGGCACT
CAAGAGACGCGCACCCGTTCCATCCTTGACATCAAGACGCGCTGCGAGGGCTCCAAGACGGTCGAGTCGGTCACC
AAGCGCGAGCTCTACTCCACCTGGTTCCTCGCCAGCGACCTTGCTGTCCTGCCCGAAGAATACACAAAGTCGCGC
CGCCGCCTCCGCGCCGTCACCCCCGTGCTGTCGTGCCTGCGCGCCCTCTGGGAATTCAAGCAGCTGTGCGGCCCG
CATGCCAAGCCCTCGACCCGCGACGACCTCAAGCTCTTTACCCAGCTCGCCACCCAGAAGCACAAGCGCCTCGGC
CTTCCCTCCGAGACCCTCTCGTCCGCCTTTTTGCGCAGCTTTTTGCAAAACCTGGGCGCTGAAATGGCCCCCGTC
ACTGCCATTCTGGGCGGCCAGCTGGCCCAAGACGTCATCAATGTCTTGGGCCATTCGCAGCAGCCCATTCAAAAC
ATGGTGGTCTTTGACGGCGACCGCCTCGAGGCTGCCATGTATCCCCTGCATCCAGAAGGCTCTCTTGGCGCAAGC
CTGCTCTCGCTTGGGAGCGCCACCCTCACCGACCCAGACGCCCTTGCTGCCCAGAACGCCCTGCTCGACTCCCTC
GCCGGCCCCGCTGTCCTGCCCGGCCCTACTGCCATGCCCGGAGCCCTGGGCTCTGCCGTACCCCTCGCCATGGGC
AATCATGTCGCTGTCGCCCTACCCTTTGCGGCTGAGGCCCCTGTACCCTCTGCCTCGGATCACCATGGGACAGAA
CAGCTCGATGCGTCATAG
Transcript >OphauG2|3814
ATGACGCCGGGAAGCCACGACGTTGCAGAAGACGAGGGCGCTGCCGCCAACAGCCATAGCGACAAGCACAGCGAC
AAGCATAGCGACAAGCATAGCATCAACCACACCATCAACCACACCAACAACCACACCAACAAGCCCCCCATGGCT
CATCACCAAGACGCCGCCATGGCTGCTTCCATGATGGCTCCCCATCCCCTCGCCCAGCAGCAGCCCGCGTCCGCC
ACTGATGCAAACACGCTCATGGCGCCAAACGGCGGCGCGCCGGTGCACACGCAACAAGTCTCTGCAGACGATGTT
GCGCTCTATGACCGCCAGATCCGGCTCTGGGGAATGGCTGCTCAGGCCAGCATTCAAAGGGCAAATATCCTCATC
ATCACTATGCGCGCCCTGGCAAACGAAGTGGCCAAGAATCTCGTGCTGGCTGGCATCGGCTCCTTGACCCTGCTC
GACGACGCTGTTGCCACCGAGGCCGACTTGGGCGCCCAGTTCTTGCTGGCCGATGTGGCCAACGTGGTGGGCCAG
AAGCGCGCCCAGGCCGCCAGCCTTGCCCTCACCAAGCTCAACCCGCGCGTGCGCATCCACGTCGACGCCGACAGC
GTGGCAAACAAGCGGCCCAACTACTTTGCCGCCTTTGACGTGGTGATTGCCACGGACCTGGACCCCGACTCCTTC
AACATCATCAACACGGCCACCCGCCTCAACAACAAGGCCTTTTACGCCGCCGGCACCCATGGGCTCTACGGCTTC
ATCTTTCTCGATCTGATTGAGCACGACTACGTCATTGAGCGCGACCCTTCCAACGTGCCCGCCCGCCCCGGCACT
CAAGAGACGCGCACCCGTTCCATCCTTGACATCAAGACGCGCTGCGAGGGCTCCAAGACGGTCGAGTCGGTCACC
AAGCGCGAGCTCTACTCCACCTGGTTCCTCGCCAGCGACCTTGCTGTCCTGCCCGAAGAATACACAAAGTCGCGC
CGCCGCCTCCGCGCCGTCACCCCCGTGCTGTCGTGCCTGCGCGCCCTCTGGGAATTCAAGCAGCTGTGCGGCCCG
CATGCCAAGCCCTCGACCCGCGACGACCTCAAGCTCTTTACCCAGCTCGCCACCCAGAAGCACAAGCGCCTCGGC
CTTCCCTCCGAGACCCTCTCGTCCGCCTTTTTGCGCAGCTTTTTGCAAAACCTGGGCGCTGAAATGGCCCCCGTC
ACTGCCATTCTGGGCGGCCAGCTGGCCCAAGACGTCATCAATGTCTTGGGCCATTCGCAGCAGCCCATTCAAAAC
ATGGTGGTCTTTGACGGCGACCGCCTCGAGGCTGCCATGTATCCCCTGCATCCAGAAGGCTCTCTTGGCGCAAGC
CTGCTCTCGCTTGGGAGCGCCACCCTCACCGACCCAGACGCCCTTGCTGCCCAGAACGCCCTGCTCGACTCCCTC
GCCGGCCCCGCTGTCCTGCCCGGCCCTACTGCCATGCCCGGAGCCCTGGGCTCTGCCGTACCCCTCGCCATGGGC
AATCATGTCGCTGTCGCCCTACCCTTTGCGGCTGAGGCCCCTGTACCCTCTGCCTCGGATCACCATGGGACAGAA
CAGCTCGATGCGTCATAG
Gene >OphauG2|3814
ATGACGCCGGGAAGCCACGACGTTGCAGAAGACGAGGGCGCTGCCGCCAACAGCCATAGCGACAAGCACAGCGAC
AAGCATAGCGACAAGCATAGCATCAACCACACCATCAACCACACCAACAACCACACCAACAAGCCCCCCATGGCT
CATCACCAAGACGCCGCCATGGCTGCTTCCATGATGGCTCCCCATCCCCTCGCCCAGCAGCAGCCCGCGTCCGCC
ACTGATGCAAACACGCTCATGGCGCCAAACGGCGGCGCGCCGGTGCACACGCAACAAGTCTCTGCAGGTGCGGCT
TGCGCGACGAGCCACAAGATGAGGCACCATTGGAAGCAAAAATGGAAAAAAGGCGGCTGACATGGCGCTGCAGAC
GATGTTGCGCTCTATGACCGCCAGATCCGGCTCTGGGGAATGGCTGCTCAGGCCAGCATTCAAAGGGCAAATATC
CTCATCATCACTATGCGCGCCCTGGCAAACGAAGTGGCCAAGAATCTCGTGCTGGCTGGCATCGGCTCCTTGACC
CTGCTCGACGACGCTGTTGCCACCGAGGCCGACTTGGGCGCCCAGTTCTTGCTGGCCGATGTGGCCAACGTGGTG
GGCCAGAAGCGCGCCCAGGCCGCCAGCCTTGCCCTCACCAAGCTCAACCCGCGCGTGCGCATCCACGTCGACGCC
GACAGCGTGGCAAACAAGCGGCCCAACTACTTTGCCGCCTTTGACGTGGTGATTGCCACGGACCTGGACCCCGAC
TCCTTCAACATCATCAACACGGCCACCCGCCTCAACAACAAGGCCTTTTACGCCGCCGGCACCCATGGGCTCTAC
GGCTTCATCTTTCTCGATCTGATTGAGCACGACTACGTCATTGAGCGCGACCCTTCCAACGTGCCCGCCCGCCCC
GGCACTCAAGAGACGCGCACCCGTTCCATCCTTGACATCAAGACGCGCTGCGAGGGCTCCAAGACGGTCGAGTCG
GTCACCAAGCGCGAGCTCTACTCCACCTGGTTCCTCGCCAGCGACCTTGCTGTCCTGCCCGAAGAATACACAAAG
TCGCGCCGCCGCCTCCGCGCCGTCACCCCCGTGCTGTCGTGCCTGCGCGCCCTCTGGGAATTCAAGCAGCTGTGC
GGCCCGCATGCCAAGCCCTCGACCCGCGACGACCTCAAGCTCTTTACCCAGCTCGCCACCCAGAAGCACAAGCGC
CTCGGCCTTCCCTCCGAGACCCTCTCGTCCGCCTTTTTGCGCAGCTTTTTGCAAAACCTGGGCGCTGAAATGGCC
CCCGTCACTGCCATTCTGGGCGGCCAGCTGGCCCAAGACGTCATCAATGTCTTGGGCCATTCGCAGCAGCCCATT
CAAAACATGGTGGTCTTTGACGGCGACCGCCTCGAGGCTGCCATGTATCCCCTGCATCCAGAAGGCTCTCTTGGC
GCAAGCCTGCTCTCGCTTGGGAGCGCCACCCTCACCGACCCAGACGCCCTTGCTGCCCAGAACGCCCTGCTCGAC
TCCCTCGCCGGCCCCGCTGTCCTGCCCGGCCCTACTGCCATGCCCGGAGCCCTGGGCTCTGCCGTACCCCTCGCC
ATGGGCAATCATGTCGCTGTCGCCCTACCCTTTGCGGCTGAGGCCCCTGTACCCTCTGCCTCGGATCACCATGGG
ACAGAACAGCTCGATGCGTCATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail