Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|381
Gene name
LocationContig_109:438..1738
Strand+
Gene length (bp)1300
Transcript length (bp)1113
Coding sequence length (bp)1113
Protein length (aa) 371

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08569 Mo25 Mo25-like 2.4E-133 3 361

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O60032|HYMA_EMENI Conidiophore development protein hymA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=hymA PE=3 SV=1 1 367 3.0E-154
sp|Q9P7Q8|PMO25_SCHPO Mo25-like protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pmo25 PE=3 SV=1 1 360 6.0E-75
sp|Q9H9S4|CB39L_HUMAN Calcium-binding protein 39-like OS=Homo sapiens GN=CAB39L PE=1 SV=3 4 360 2.0E-74
sp|Q9DB16|CB39L_MOUSE Calcium-binding protein 39-like OS=Mus musculus GN=Cab39l PE=1 SV=3 4 360 3.0E-74
sp|Q9Y376|CAB39_HUMAN Calcium-binding protein 39 OS=Homo sapiens GN=CAB39 PE=1 SV=1 1 360 3.0E-69
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O60032|HYMA_EMENI Conidiophore development protein hymA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=hymA PE=3 SV=1 1 367 3.0E-154
sp|Q9P7Q8|PMO25_SCHPO Mo25-like protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pmo25 PE=3 SV=1 1 360 6.0E-75
sp|Q9H9S4|CB39L_HUMAN Calcium-binding protein 39-like OS=Homo sapiens GN=CAB39L PE=1 SV=3 4 360 2.0E-74
sp|Q9DB16|CB39L_MOUSE Calcium-binding protein 39-like OS=Mus musculus GN=Cab39l PE=1 SV=3 4 360 3.0E-74
sp|Q9Y376|CAB39_HUMAN Calcium-binding protein 39 OS=Homo sapiens GN=CAB39 PE=1 SV=1 1 360 3.0E-69
sp|Q29RI6|CAB39_BOVIN Calcium-binding protein 39 OS=Bos taurus GN=CAB39 PE=2 SV=1 1 360 3.0E-69
sp|Q06138|CAB39_MOUSE Calcium-binding protein 39 OS=Mus musculus GN=Cab39 PE=1 SV=2 1 360 3.0E-69
sp|O18211|MO25M_CAEEL MO25-like protein 2 OS=Caenorhabditis elegans GN=mop-25.2 PE=3 SV=1 4 360 4.0E-69
sp|P91891|MO25_DROME Protein Mo25 OS=Drosophila melanogaster GN=Mo25 PE=2 SV=2 4 364 4.0E-66
sp|Q9FGK3|MO25N_ARATH Putative MO25-like protein At5g47540 OS=Arabidopsis thaliana GN=At5g47540 PE=2 SV=1 1 362 1.0E-60
sp|Q9M0M4|MO25M_ARATH Putative MO25-like protein At4g17270 OS=Arabidopsis thaliana GN=At4g17270 PE=2 SV=1 7 360 4.0E-56
sp|Q9XFY6|DEE76_AUXPR Degreening-related gene dee76 protein OS=Auxenochlorella protothecoides GN=DEE76 PE=2 SV=1 18 360 2.0E-47
sp|Q9ZQ77|MO25L_ARATH MO25-like protein At2g03410 OS=Arabidopsis thaliana GN=At2g03410 PE=2 SV=1 38 370 5.0E-43
sp|P32464|HYM1_YEAST Protein HYM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HYM1 PE=1 SV=1 1 363 2.0E-37
sp|A8X6J7|MO25L_CAEBR MO25-like protein 3 OS=Caenorhabditis briggsae GN=mop-25.3 PE=3 SV=1 135 349 1.0E-07
sp|Q9TZM2|MO25L_CAEEL MO25-like protein 3 OS=Caenorhabditis elegans GN=mop-25.3 PE=3 SV=1 135 333 3.0E-06
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5155
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|381 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|8167
Ophiocordyceps camponoti-floridani Ophcf2|01812
Ophiocordyceps camponoti-rufipedis Ophun1|4893
Ophiocordyceps kimflemingae Ophio5|1024
Ophiocordyceps subramaniannii Hirsu2|3627

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|381
MSFLFGRARPRPAADLPRQAREHLLRLDGPNGASKADDLARVLSQMKLILQGSHETDSSPEQIYQLVTSLIDEDL
LLLLAVNLHHLPFESRKDTQVVLSYVFRFRPASAAPKSDPIALSYVVCNRPQVLVELCRAYDHKESATPAGSVLR
DLLKNEAAAAIILHDDGDEPGSSAKGLNAIDRDRPQSGRGVFWRFFDWIDKSSFEVAADAFTTFREILTRHKDLI
PRYLTVNFDLFFEKYNSTLVQSNSYVTKRQSMKLLGEILLDRSNYSVMTAYIDRGDHLKICMNLLRDDRKMVQYE
GFHVFKVFVANPHKSIAVQKILLMNREKLLTFLSHFLEDRTDDEQFIDEREFLIKQIRSMPPIPTPPPQR*
Coding >OphauG2|381
ATGTCTTTTCTCTTTGGCCGCGCCCGGCCTCGACCTGCCGCTGACCTGCCTCGGCAAGCCCGCGAGCATCTTCTC
AGACTCGACGGGCCCAATGGAGCCTCCAAGGCAGACGATCTCGCCCGCGTCCTGAGCCAGATGAAGCTGATTCTG
CAGGGTTCGCATGAGACGGATAGTTCGCCCGAGCAAATCTACCAACTCGTCACCAGCCTCATTGACGAGGACCTT
CTGCTGTTACTCGCCGTCAATCTCCACCATCTGCCCTTTGAATCTCGCAAAGACACCCAGGTAGTCCTGTCATAT
GTCTTTCGCTTCCGCCCTGCTTCCGCTGCTCCCAAAAGCGACCCTATAGCCCTGTCGTACGTGGTATGCAACCGG
CCCCAAGTCCTAGTTGAGCTGTGCAGGGCCTACGACCATAAAGAGAGTGCGACACCTGCCGGCTCTGTATTGCGC
GATCTGCTCAAGAACGAAGCTGCTGCCGCAATCATCCTCCACGATGACGGGGATGAACCAGGCTCCAGTGCAAAA
GGCCTCAACGCCATTGATCGCGACAGACCTCAATCAGGCCGTGGAGTCTTTTGGCGATTCTTCGATTGGATCGAC
AAGAGCTCATTCGAAGTGGCTGCCGACGCCTTTACCACCTTTAGAGAAATATTAACGCGGCACAAGGATCTAATT
CCCCGCTACCTCACTGTCAATTTTGACCTCTTCTTCGAAAAATACAACAGTACCCTGGTACAATCAAATAGCTAC
GTCACAAAAAGACAGTCTATGAAACTGCTCGGTGAAATATTACTTGACCGCTCAAATTATAGCGTCATGACGGCC
TATATTGATCGCGGCGACCACCTCAAGATATGCATGAATTTGCTGCGCGACGACAGGAAAATGGTGCAATATGAA
GGCTTCCACGTCTTCAAAGTCTTTGTTGCCAACCCTCACAAGTCTATTGCTGTTCAAAAAATACTCCTTATGAAT
CGCGAAAAGCTCCTGACTTTTTTATCTCATTTTCTCGAAGACCGCACAGACGACGAGCAGTTTATTGACGAACGA
GAGTTCCTCATCAAGCAAATCAGAAGTATGCCGCCAATACCAACACCCCCTCCTCAACGATAG
Transcript >OphauG2|381
ATGTCTTTTCTCTTTGGCCGCGCCCGGCCTCGACCTGCCGCTGACCTGCCTCGGCAAGCCCGCGAGCATCTTCTC
AGACTCGACGGGCCCAATGGAGCCTCCAAGGCAGACGATCTCGCCCGCGTCCTGAGCCAGATGAAGCTGATTCTG
CAGGGTTCGCATGAGACGGATAGTTCGCCCGAGCAAATCTACCAACTCGTCACCAGCCTCATTGACGAGGACCTT
CTGCTGTTACTCGCCGTCAATCTCCACCATCTGCCCTTTGAATCTCGCAAAGACACCCAGGTAGTCCTGTCATAT
GTCTTTCGCTTCCGCCCTGCTTCCGCTGCTCCCAAAAGCGACCCTATAGCCCTGTCGTACGTGGTATGCAACCGG
CCCCAAGTCCTAGTTGAGCTGTGCAGGGCCTACGACCATAAAGAGAGTGCGACACCTGCCGGCTCTGTATTGCGC
GATCTGCTCAAGAACGAAGCTGCTGCCGCAATCATCCTCCACGATGACGGGGATGAACCAGGCTCCAGTGCAAAA
GGCCTCAACGCCATTGATCGCGACAGACCTCAATCAGGCCGTGGAGTCTTTTGGCGATTCTTCGATTGGATCGAC
AAGAGCTCATTCGAAGTGGCTGCCGACGCCTTTACCACCTTTAGAGAAATATTAACGCGGCACAAGGATCTAATT
CCCCGCTACCTCACTGTCAATTTTGACCTCTTCTTCGAAAAATACAACAGTACCCTGGTACAATCAAATAGCTAC
GTCACAAAAAGACAGTCTATGAAACTGCTCGGTGAAATATTACTTGACCGCTCAAATTATAGCGTCATGACGGCC
TATATTGATCGCGGCGACCACCTCAAGATATGCATGAATTTGCTGCGCGACGACAGGAAAATGGTGCAATATGAA
GGCTTCCACGTCTTCAAAGTCTTTGTTGCCAACCCTCACAAGTCTATTGCTGTTCAAAAAATACTCCTTATGAAT
CGCGAAAAGCTCCTGACTTTTTTATCTCATTTTCTCGAAGACCGCACAGACGACGAGCAGTTTATTGACGAACGA
GAGTTCCTCATCAAGCAAATCAGAAGTATGCCGCCAATACCAACACCCCCTCCTCAACGATAG
Gene >OphauG2|381
ATGTCTTTTCTCTTTGGCCGCGCCCGGCCTCGACCTGCCGCTGACCTGCCTCGGCAAGCCCGCGAGCATCTTCTC
AGACTCGACGGGCCCAATGGAGCCTCCAAGGTGCGAGCGACTGGCTCGCCGTCAGCATCAATGCTTGGCCGCTGA
CCCATGGCGCCAGGCAGACGATCTCGCCCGCGTCCTGAGCCAGATGAAGCTGATTCTGCAGGGTTCGCATGGTAC
TCAGACCTGCCTTTGTTATTGGCGTCCTGGAGGCACTAATAACCGCCATGGTCACAGAGACGGATAGTTCGCCCG
AGCAAATCTACCAACTCGTCACCAGCCTCATTGACGAGGACCTTCTGCTGTTACTCGCCGTCAATCTCCACCATC
TGCCCTTTGAATCTCGCAAAGACACCCAGGTAGTCCTGTCATATGTCTTTCGCTTCCGCCCTGCTTCCGCTGCTC
CCAAAAGCGACCCTATAGCCCTGTCGTACGTGGTATGCAACCGGCCCCAAGTCCTAGTTGAGCTGTGCAGGGCCT
ACGACCATAAAGAGAGTGCGACACCTGCCGGCTCTGTATTGCGCGATCTGCTCAAGAACGAAGCTGCTGCCGCAA
TCATCCTCCACGATGACGGGGATGAACCAGGCTCCAGTGCAAAAGGCCTCAACGCCATTGATCGCGACAGACCTC
AATCAGGCCGTGGAGTCTTTTGGCGATTCTTCGATTGGATCGACAAGAGCTCATTCGAAGTGGCTGCCGACGCCT
TTACCACCTTTAGAGTATGCCCTTGGCCACATTGGCCACTGTGTGCCCAAACTACCTCCCCGGTCACTGACCCGT
CTCCTAGGAAATATTAACGCGGCACAAGGATCTAATTCCCCGCTACCTCACTGTCAATTTTGACCTCTTCTTCGA
AAAATACAACAGTACCCTGGTACAATCAAATAGCTACGTCACAAAAAGACAGTCTATGAAACTGCTCGGTGAAAT
ATTACTTGACCGCTCAAATTATAGCGTCATGACGGCCTATATTGATCGCGGCGACCACCTCAAGATATGCATGAA
TTTGCTGCGCGACGACAGGAAAATGGTGCAATATGAAGGCTTCCACGTCTTCAAAGTCTTTGTTGCCAACCCTCA
CAAGTCTATTGCTGTTCAAAAAATACTCCTTATGAATCGCGAAAAGCTCCTGACTTTTTTATCTCATTTTCTCGA
AGACCGCACAGACGACGAGCAGTTTATTGACGAACGAGAGTTCCTCATCAAGCAAATCAGAAGTATGCCGCCAAT
ACCAACACCCCCTCCTCAACGATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail