Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|3808
Gene name
LocationContig_3:23119..24476
Strand+
Gene length (bp)1357
Transcript length (bp)1203
Coding sequence length (bp)1203
Protein length (aa) 401

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10607 CTLH CTLH/CRA C-terminal to LisH motif domain 1.3E-30 164 305
PF08513 LisH LisH 6.0E-05 129 152

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q7S2X0|FYV10_NEUCR Protein fyv-10 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=fyv-10 PE=3 SV=1 1 398 6.0E-135
sp|Q2H991|FYV10_CHAGB Protein FYV10 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=FYV10 PE=3 SV=1 1 400 1.0E-134
sp|A4RK04|FYV10_MAGO7 Protein FYV10 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=FYV10 PE=3 SV=2 1 400 2.0E-134
sp|Q5AS80|FYV10_EMENI Protein fyv10 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=fyv10 PE=3 SV=2 25 399 1.0E-109
sp|Q1DTI6|FYV10_COCIM Protein FYV10 OS=Coccidioides immitis (strain RS) GN=FYV10 PE=3 SV=1 9 400 2.0E-104
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q7S2X0|FYV10_NEUCR Protein fyv-10 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=fyv-10 PE=3 SV=1 1 398 6.0E-135
sp|Q2H991|FYV10_CHAGB Protein FYV10 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=FYV10 PE=3 SV=1 1 400 1.0E-134
sp|A4RK04|FYV10_MAGO7 Protein FYV10 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=FYV10 PE=3 SV=2 1 400 2.0E-134
sp|Q5AS80|FYV10_EMENI Protein fyv10 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=fyv10 PE=3 SV=2 25 399 1.0E-109
sp|Q1DTI6|FYV10_COCIM Protein FYV10 OS=Coccidioides immitis (strain RS) GN=FYV10 PE=3 SV=1 9 400 2.0E-104
sp|A1C9R2|FYV10_ASPCL Protein fyv10 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=fyv10 PE=3 SV=1 9 399 1.0E-103
sp|Q0TYW1|FYV10_PHANO Protein FYV10 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=FYV10 PE=3 SV=2 9 399 1.0E-100
sp|Q0CA25|FYV10_ASPTN Protein fyv10 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=fyv10 PE=3 SV=2 25 399 2.0E-99
sp|A1CZJ5|FYV10_NEOFI Protein fyv10 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=fyv10 PE=3 SV=2 25 399 4.0E-98
sp|A2R9P6|FYV10_ASPNC Protein fyv10 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=fyv10 PE=3 SV=2 25 399 8.0E-98
sp|Q4WTQ4|FYV10_ASPFU Protein fyv10 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=fyv10 PE=3 SV=2 25 399 2.0E-97
sp|Q5R532|MAEA_PONAB Macrophage erythroblast attacher OS=Pongo abelii GN=MAEA PE=2 SV=1 22 399 2.0E-56
sp|Q7L5Y9|MAEA_HUMAN Macrophage erythroblast attacher OS=Homo sapiens GN=MAEA PE=1 SV=1 22 399 2.0E-56
sp|Q4R9A8|MAEA_MACFA Macrophage erythroblast attacher OS=Macaca fascicularis GN=MAEA PE=2 SV=1 22 399 3.0E-56
sp|Q5RKJ1|MAEA_RAT Macrophage erythroblast attacher OS=Rattus norvegicus GN=Maea PE=2 SV=2 22 399 6.0E-55
sp|Q4VC33|MAEA_MOUSE Macrophage erythroblast attacher OS=Mus musculus GN=Maea PE=1 SV=1 22 399 6.0E-55
sp|Q7SXR3|MAEA_DANRE Macrophage erythroblast attacher OS=Danio rerio GN=maea PE=2 SV=2 22 399 1.0E-53
sp|Q6GR10|MAEA_XENLA Macrophage erythroblast attacher OS=Xenopus laevis GN=maea PE=2 SV=2 22 399 2.0E-53
sp|Q5F398|MAEA_CHICK Macrophage erythroblast attacher OS=Gallus gallus GN=MAEA PE=2 SV=1 22 399 3.0E-53
sp|Q9URU9|FYV10_SCHPO Protein fyv10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fyv10 PE=3 SV=1 13 400 2.0E-49
sp|Q3MHJ2|MAEA_BOVIN Macrophage erythroblast attacher OS=Bos taurus GN=MAEA PE=2 SV=1 22 399 3.0E-48
sp|Q6C435|FYV10_YARLI Protein FYV10 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=FYV10 PE=3 SV=1 8 312 9.0E-48
sp|Q6CP05|FYV10_KLULA Protein FYV10 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=FYV10 PE=3 SV=1 14 400 1.0E-27
sp|Q75AZ2|FYV10_ASHGO Protein FYV10 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=FYV10 PE=3 SV=1 14 400 6.0E-21
sp|Q6FTG6|FYV10_CANGA Protein FYV10 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=FYV10 PE=3 SV=1 14 253 3.0E-14
sp|Q6FTG6|FYV10_CANGA Protein FYV10 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=FYV10 PE=3 SV=1 267 400 3.0E-12
sp|Q91YQ7|RMD5B_MOUSE Protein RMD5 homolog B OS=Mus musculus GN=Rmnd5b PE=2 SV=1 39 302 3.0E-11
sp|P40492|FYV10_YEAST Protein FYV10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FYV10 PE=1 SV=1 14 363 1.0E-10
sp|Q96G75|RMD5B_HUMAN Protein RMD5 homolog B OS=Homo sapiens GN=RMND5B PE=1 SV=1 53 302 1.0E-09
sp|Q6PC55|GID8_DANRE Glucose-induced degradation protein 8 homolog OS=Danio rerio GN=gid8 PE=2 SV=1 113 214 2.0E-09
sp|Q9NWU2|GID8_HUMAN Glucose-induced degradation protein 8 homolog OS=Homo sapiens GN=GID8 PE=1 SV=1 111 223 2.0E-09
sp|Q9D7M1|GID8_MOUSE Glucose-induced degradation protein 8 homolog OS=Mus musculus GN=Gid8 PE=1 SV=1 111 223 2.0E-09
sp|Q32L52|GID8_BOVIN Glucose-induced degradation protein 8 homolog OS=Bos taurus GN=GID8 PE=2 SV=1 125 223 4.0E-09
sp|Q80YQ8|RMD5A_MOUSE Protein RMD5 homolog A OS=Mus musculus GN=Rmnd5a PE=1 SV=2 105 302 6.0E-09
sp|Q9H871|RMD5A_HUMAN Protein RMD5 homolog A OS=Homo sapiens GN=RMND5A PE=1 SV=1 105 302 6.0E-09
sp|Q5ZKQ7|GID8_CHICK Glucose-induced degradation protein 8 homolog OS=Gallus gallus GN=GID8 PE=2 SV=1 111 223 7.0E-09
sp|Q640V2|RMD5A_XENTR Protein RMD5 homolog A OS=Xenopus tropicalis GN=rmnd5a PE=2 SV=1 129 302 3.0E-08
sp|Q6C435|FYV10_YARLI Protein FYV10 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=FYV10 PE=3 SV=1 326 398 6.0E-08
sp|Q6GLP4|RMD5A_XENLA Protein RMD5 homolog A OS=Xenopus laevis GN=rmnd5a PE=2 SV=1 105 302 7.0E-08
sp|A7SWD3|GID8_NEMVE Glucose-induced degradation protein 8 homolog OS=Nematostella vectensis GN=v1g247787 PE=3 SV=1 124 251 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1904
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3808 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|6783
Ophiocordyceps camponoti-floridani Ophcf2|03644
Ophiocordyceps camponoti-rufipedis Ophun1|1307
Ophiocordyceps kimflemingae Ophio5|7422
Ophiocordyceps subramaniannii Hirsu2|1997

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|3808
MGDHELSVLKHSEHLLLDQAALRLPSELLRKTFRSAHLAIEKDTSALKTLLKETGTAAVSGRASQGDVLRNMDAM
LSRIRGVKRKLTASAQEEARLHLDTAARIQHLDDLYASRTIDDVKYEAWSRIRLDRLIVDYLLRRGFHRTARELA
MERGIGRLVDVDTFTSMNRIREALLNGSVSEALAWCADNKKELRKMESKLEFMLRLQQFIELVRTQSEPKMLEAI
SHAKKHLIGSETAFPREIRQAAALLATVPGTGGNDSLYRRSRWADLADMFTEAHSTLLALPPWPLLYLALSSGLS
ALKTPACHSQSAQKGEAPSMLGHGVCPICSPELHDLARSVPYAHHNKSHVAYDLQLLPNGRAYGLKQLKSQALRL
PSGMVQDPHTGQRYNTTQLKKVYIT*
Coding >OphauG2|3808
ATGGGCGACCACGAGCTGTCGGTGCTCAAGCACAGCGAGCATCTACTGCTGGATCAAGCTGCTCTTCGCCTCCCC
AGTGAGCTGCTACGCAAAACGTTTCGCTCAGCCCACCTGGCGATTGAAAAAGACACGTCGGCACTCAAGACACTG
CTCAAGGAGACGGGCACGGCGGCGGTGTCGGGGCGGGCGTCGCAGGGCGATGTGCTTCGCAACATGGACGCCATG
CTGTCTCGCATCCGCGGCGTCAAGCGCAAGCTGACGGCATCGGCCCAAGAAGAAGCCCGCCTTCATCTCGACACG
GCGGCGCGCATCCAGCACCTCGACGACTTGTACGCAAGCCGCACCATTGACGACGTCAAGTACGAGGCCTGGAGC
CGCATCAGGCTGGACCGCCTGATTGTCGACTACTTGCTGCGCCGCGGCTTCCACCGCACCGCTCGCGAGCTGGCC
ATGGAGAGGGGCATTGGACGCTTGGTGGACGTGGACACGTTTACAAGCATGAACCGCATCCGAGAGGCGCTGCTC
AACGGCAGCGTCAGCGAGGCACTGGCCTGGTGTGCCGACAACAAGAAGGAGCTGCGCAAGATGGAGAGCAAACTC
GAGTTTATGCTTCGTCTGCAGCAGTTTATCGAGCTTGTGCGTACCCAGTCGGAGCCCAAGATGCTCGAGGCTATT
AGCCACGCAAAGAAGCACCTGATTGGCTCCGAGACGGCTTTCCCCCGCGAGATTCGCCAGGCCGCCGCCCTGCTG
GCCACGGTGCCTGGCACGGGCGGCAACGACAGCCTGTACCGCCGCTCGCGCTGGGCCGACCTGGCCGACATGTTT
ACCGAGGCTCACAGCACCCTGCTGGCCCTGCCGCCCTGGCCGCTGCTGTACCTGGCCCTGTCGTCGGGCCTGTCG
GCTCTCAAGACGCCCGCCTGCCACTCGCAGTCGGCCCAAAAGGGCGAGGCCCCGTCCATGCTGGGCCACGGCGTC
TGTCCCATTTGCTCGCCCGAGCTGCACGACTTGGCCCGCAGCGTGCCCTATGCCCATCATAACAAGAGCCACGTT
GCCTATGACCTTCAGCTGCTGCCCAATGGCCGGGCATATGGCCTCAAGCAACTCAAGAGCCAGGCTTTGCGTCTG
CCCTCGGGCATGGTGCAGGATCCTCACACCGGCCAGAGATACAACACGACGCAGCTGAAAAAGGTCTACATAACT
TAG
Transcript >OphauG2|3808
ATGGGCGACCACGAGCTGTCGGTGCTCAAGCACAGCGAGCATCTACTGCTGGATCAAGCTGCTCTTCGCCTCCCC
AGTGAGCTGCTACGCAAAACGTTTCGCTCAGCCCACCTGGCGATTGAAAAAGACACGTCGGCACTCAAGACACTG
CTCAAGGAGACGGGCACGGCGGCGGTGTCGGGGCGGGCGTCGCAGGGCGATGTGCTTCGCAACATGGACGCCATG
CTGTCTCGCATCCGCGGCGTCAAGCGCAAGCTGACGGCATCGGCCCAAGAAGAAGCCCGCCTTCATCTCGACACG
GCGGCGCGCATCCAGCACCTCGACGACTTGTACGCAAGCCGCACCATTGACGACGTCAAGTACGAGGCCTGGAGC
CGCATCAGGCTGGACCGCCTGATTGTCGACTACTTGCTGCGCCGCGGCTTCCACCGCACCGCTCGCGAGCTGGCC
ATGGAGAGGGGCATTGGACGCTTGGTGGACGTGGACACGTTTACAAGCATGAACCGCATCCGAGAGGCGCTGCTC
AACGGCAGCGTCAGCGAGGCACTGGCCTGGTGTGCCGACAACAAGAAGGAGCTGCGCAAGATGGAGAGCAAACTC
GAGTTTATGCTTCGTCTGCAGCAGTTTATCGAGCTTGTGCGTACCCAGTCGGAGCCCAAGATGCTCGAGGCTATT
AGCCACGCAAAGAAGCACCTGATTGGCTCCGAGACGGCTTTCCCCCGCGAGATTCGCCAGGCCGCCGCCCTGCTG
GCCACGGTGCCTGGCACGGGCGGCAACGACAGCCTGTACCGCCGCTCGCGCTGGGCCGACCTGGCCGACATGTTT
ACCGAGGCTCACAGCACCCTGCTGGCCCTGCCGCCCTGGCCGCTGCTGTACCTGGCCCTGTCGTCGGGCCTGTCG
GCTCTCAAGACGCCCGCCTGCCACTCGCAGTCGGCCCAAAAGGGCGAGGCCCCGTCCATGCTGGGCCACGGCGTC
TGTCCCATTTGCTCGCCCGAGCTGCACGACTTGGCCCGCAGCGTGCCCTATGCCCATCATAACAAGAGCCACGTT
GCCTATGACCTTCAGCTGCTGCCCAATGGCCGGGCATATGGCCTCAAGCAACTCAAGAGCCAGGCTTTGCGTCTG
CCCTCGGGCATGGTGCAGGATCCTCACACCGGCCAGAGATACAACACGACGCAGCTGAAAAAGGTCTACATAACT
TAG
Gene >OphauG2|3808
ATGGGCGACCACGAGCTGTCGGTGCTCAAGCACAGCGAGCATCTACTGCTGGTAAGTGGCTTGTTCTTCTCGTCG
TCGTCCTGGGCAAGCAAGCGGCCAAGCCAACACAGCGCTACAGGATCAAGCTGCTCTTCGCCTCCCCAGTGAGCT
GCTACGCAAAACGTTTCGCTCAGCCCACCTGGCGATTGAAAAAGACACGTCGGCACTCAAGACACTGCTCAAGGA
GACGGGCACGGCGGCGGTGTCGGGGCGGGCGTCGCAGGGCGATGTGCTTCGCAACATGGACGCCATGCTGTCTCG
CATCCGCGGCGTCAAGCGCAAGCTGACGGCATCGGCCCAAGAAGAAGCCCGCCTTCATCTCGACACGGCGGCGCG
CATCCAGCACCTCGACGACTTGTACGCAAGCCGCACCATTGACGACGTCAAGTACGAGGCCTGGAGCCGCATCAG
GCTGGACCGCCTGATTGTCGACTACTTGCTGCGCCGCGGCTTCCACCGCACCGCTCGCGAGCTGGCCATGGAGAG
GGGCATTGGACGCTTGGTGGACGTGGACACGTTTACAAGCATGAACCGCATCCGAGAGGCGCTGCTCAACGGCAG
CGTCAGCGAGGCACTGGCCTGGTGTGCCGACAACAAGAAGGAGCTGCGCAAGATGGAGGCGAGTCTTTTTTTTTT
TTAATTTTTTTCCAATTTTTTCCAATTTTTTAATTATTTATTTTTTGCCCTTGCTGACGCGCCAGACAAGAGCAA
ACTCGAGTTTATGCTTCGTCTGCAGCAGTTTATCGAGCTTGTGCGTACCCAGTCGGAGCCCAAGATGCTCGAGGC
TATTAGCCACGCAAAGAAGCACCTGATTGGCTCCGAGACGGCTTTCCCCCGCGAGATTCGCCAGGCCGCCGCCCT
GCTGGCCACGGTGCCTGGCACGGGCGGCAACGACAGCCTGTACCGCCGCTCGCGCTGGGCCGACCTGGCCGACAT
GTTTACCGAGGCTCACAGCACCCTGCTGGCCCTGCCGCCCTGGCCGCTGCTGTACCTGGCCCTGTCGTCGGGCCT
GTCGGCTCTCAAGACGCCCGCCTGCCACTCGCAGTCGGCCCAAAAGGGCGAGGCCCCGTCCATGCTGGGCCACGG
CGTCTGTCCCATTTGCTCGCCCGAGCTGCACGACTTGGCCCGCAGCGTGCCCTATGCCCATCATAACAAGAGCCA
CGTTGCCTATGACCTTCAGCTGCTGCCCAATGGCCGGGCATATGGCCTCAAGCAACTCAAGAGCCAGGCTTTGCG
TCTGCCCTCGGGCATGGTGCAGGATCCTCACACCGGCCAGAGATACAACACGACGCAGCTGAAAAAGGTCTACAT
AACTTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail