Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|3805
Gene name
LocationContig_3:15522..16710
Strand+
Gene length (bp)1188
Transcript length (bp)990
Coding sequence length (bp)990
Protein length (aa) 330

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04193 PQ-loop PQ loop repeat 9.7E-15 15 73
PF04193 PQ-loop PQ loop repeat 5.9E-15 211 264

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P38279|YPQ3_YEAST Probable vacuolar amino acid transporter YPQ3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RTC2 PE=1 SV=1 9 321 2.0E-51
sp|Q12010|YPQ1_YEAST Probable vacuolar amino acid transporter YPQ1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPQ1 PE=1 SV=1 30 316 2.0E-43
sp|Q10482|STM1_SCHPO Seven transmembrane protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=stm1 PE=1 SV=1 7 316 9.0E-29
sp|Q95XZ6|LAAT1_CAEEL Lysosomal amino acid transporter 1 OS=Caenorhabditis elegans GN=laat-1 PE=1 SV=2 11 328 5.0E-24
sp|Q06328|YPQ2_YEAST Probable vacuolar amino acid transporter YPQ2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPQ2 PE=1 SV=1 14 312 5.0E-19
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P38279|YPQ3_YEAST Probable vacuolar amino acid transporter YPQ3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RTC2 PE=1 SV=1 9 321 2.0E-51
sp|Q12010|YPQ1_YEAST Probable vacuolar amino acid transporter YPQ1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPQ1 PE=1 SV=1 30 316 2.0E-43
sp|Q10482|STM1_SCHPO Seven transmembrane protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=stm1 PE=1 SV=1 7 316 9.0E-29
sp|Q95XZ6|LAAT1_CAEEL Lysosomal amino acid transporter 1 OS=Caenorhabditis elegans GN=laat-1 PE=1 SV=2 11 328 5.0E-24
sp|Q06328|YPQ2_YEAST Probable vacuolar amino acid transporter YPQ2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPQ2 PE=1 SV=1 14 312 5.0E-19
sp|Q6ZP29|LAAT1_HUMAN Lysosomal amino acid transporter 1 homolog OS=Homo sapiens GN=PQLC2 PE=1 SV=1 19 322 3.0E-18
sp|Q5ZJX0|LAAT1_CHICK Lysosomal amino acid transporter 1 homolog OS=Gallus gallus GN=PQLC2 PE=2 SV=1 192 327 2.0E-15
sp|B0BMY1|LAAT1_RAT Lysosomal amino acid transporter 1 homolog OS=Rattus norvegicus GN=Pqlc2 PE=1 SV=1 19 325 8.0E-13
sp|Q8C4N4|LAAT1_MOUSE Lysosomal amino acid transporter 1 homolog OS=Mus musculus GN=Pqlc2 PE=2 SV=1 19 316 2.0E-10
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 15 33 18
2 46 68 22
3 72 94 22
4 164 186 22
5 201 223 22
6 244 266 22
7 286 308 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3247
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3805 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|6786
Ophiocordyceps camponoti-floridani Ophcf2|03637
Ophiocordyceps kimflemingae Ophio5|111
Ophiocordyceps subramaniannii Hirsu2|59
Ophiocordyceps subramaniannii Hirsu2|8686

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|3805
MASPAPAPLLDVTAISGIFGSISIAFWVVVSTPQLIQQYRQGNANGLSIRFMTIWVLGDVFNVLGALLQGVLPTM
IILAIYYIFADGILWLQCFYYRGFRLRDEPPPAPLLAHMPPGECTALLPSSDLEERPIYEWPSLGPTVPDAHQDA
LAGEKNPSKGLQNALIKAGIVTLISLTGVLGWYISHLVASWGDKHEPVDQGQGTPLEFNVLGQIFGYVCTVFYTC
SRMPQLILNWRRKTTNGLSILFFMFTCLGNVNFALSILIYVPTCADAVCKPGEASQIYWRYILINLSWLSGCLLT
LALDLCILAQYYAYQKPSGEKEQAQIAAD*
Coding >OphauG2|3805
ATGGCCTCTCCTGCTCCAGCCCCTTTGCTCGATGTCACAGCCATTTCGGGCATTTTTGGCTCTATTTCCATTGCC
TTTTGGGTCGTCGTTTCCACGCCCCAGTTGATCCAGCAGTATAGACAAGGAAACGCAAATGGTCTCTCCATTCGC
TTCATGACCATTTGGGTCCTTGGCGATGTCTTCAATGTATTGGGCGCCCTGTTGCAGGGCGTTCTCCCCACAATG
ATCATCTTGGCCATTTACTACATCTTTGCAGACGGTATCCTCTGGCTACAGTGCTTCTATTATCGTGGTTTCAGG
CTACGTGACGAACCACCGCCCGCTCCTTTATTGGCTCACATGCCTCCAGGAGAATGCACAGCTCTGCTCCCAAGT
AGCGACCTTGAGGAGCGTCCCATTTATGAGTGGCCTAGTTTGGGCCCCACAGTCCCAGATGCCCATCAAGATGCC
TTGGCTGGCGAAAAGAACCCATCAAAGGGGTTGCAAAATGCCTTGATCAAGGCCGGCATTGTCACTCTCATTTCC
TTGACTGGTGTCTTGGGCTGGTACATATCACATCTGGTGGCTAGCTGGGGTGACAAGCACGAGCCCGTCGATCAA
GGCCAGGGGACCCCACTCGAGTTCAACGTGCTGGGCCAAATATTTGGCTACGTTTGCACCGTCTTTTATACTTGC
TCACGTATGCCCCAGCTCATCCTCAACTGGCGTCGCAAAACGACAAACGGCCTGAGCATTCTCTTCTTCATGTTT
ACCTGCCTTGGAAACGTCAACTTTGCCCTGTCCATTCTCATATACGTCCCCACTTGCGCTGATGCTGTTTGCAAG
CCAGGCGAGGCCAGCCAGATATACTGGCGCTACATCTTGATTAATCTGAGTTGGCTTTCAGGCTGCTTACTGACA
TTGGCCTTGGATCTATGCATTCTTGCACAATACTACGCATATCAGAAACCTAGTGGTGAGAAAGAACAGGCCCAA
ATAGCTGCCGACTAG
Transcript >OphauG2|3805
ATGGCCTCTCCTGCTCCAGCCCCTTTGCTCGATGTCACAGCCATTTCGGGCATTTTTGGCTCTATTTCCATTGCC
TTTTGGGTCGTCGTTTCCACGCCCCAGTTGATCCAGCAGTATAGACAAGGAAACGCAAATGGTCTCTCCATTCGC
TTCATGACCATTTGGGTCCTTGGCGATGTCTTCAATGTATTGGGCGCCCTGTTGCAGGGCGTTCTCCCCACAATG
ATCATCTTGGCCATTTACTACATCTTTGCAGACGGTATCCTCTGGCTACAGTGCTTCTATTATCGTGGTTTCAGG
CTACGTGACGAACCACCGCCCGCTCCTTTATTGGCTCACATGCCTCCAGGAGAATGCACAGCTCTGCTCCCAAGT
AGCGACCTTGAGGAGCGTCCCATTTATGAGTGGCCTAGTTTGGGCCCCACAGTCCCAGATGCCCATCAAGATGCC
TTGGCTGGCGAAAAGAACCCATCAAAGGGGTTGCAAAATGCCTTGATCAAGGCCGGCATTGTCACTCTCATTTCC
TTGACTGGTGTCTTGGGCTGGTACATATCACATCTGGTGGCTAGCTGGGGTGACAAGCACGAGCCCGTCGATCAA
GGCCAGGGGACCCCACTCGAGTTCAACGTGCTGGGCCAAATATTTGGCTACGTTTGCACCGTCTTTTATACTTGC
TCACGTATGCCCCAGCTCATCCTCAACTGGCGTCGCAAAACGACAAACGGCCTGAGCATTCTCTTCTTCATGTTT
ACCTGCCTTGGAAACGTCAACTTTGCCCTGTCCATTCTCATATACGTCCCCACTTGCGCTGATGCTGTTTGCAAG
CCAGGCGAGGCCAGCCAGATATACTGGCGCTACATCTTGATTAATCTGAGTTGGCTTTCAGGCTGCTTACTGACA
TTGGCCTTGGATCTATGCATTCTTGCACAATACTACGCATATCAGAAACCTAGTGGTGAGAAAGAACAGGCCCAA
ATAGCTGCCGACTAG
Gene >OphauG2|3805
ATGGCCTCTCCTGCTCCAGCCCCTTTGCTCGATGTCACAGCCATTTCGGGCATTTTTGGGTCAGCTCCCCTGCCC
CTTTCCCTCGCCGCTCTTTATTCAGTTCTGACGACAGCCTCATCTCCAGCTCTATTTCCATTGCCTTTTGGGGTC
AGTGCGACTTTCCCTGCCGCACGCTCGCCCATCTTGATTGCGAGCCCCCCGTGCGCCAACTGACGCCCAGGTAGT
CGTCGTTTCCACGCCCCAGTTGATCCAGCAGTATAGACAAGGAAACGCAAATGGTCTCTCCATTCGCTTCATGAC
CATTTGGGTCCTTGGCGATGTCTTCAATGTATTGGGCGCCCTGTTGCAGGGCGTTCTCCCCACAATGGTATGCTG
CCCCAAGAACCTTGAACCATGCCCCATGTCTCACTCTTTGCCCTATAGATCATCTTGGCCATTTACTACATCTTT
GCAGACGGTATCCTCTGGCTACAGTGCTTCTATTATCGTGGTTTCAGGCTACGTGACGAACCACCGCCCGCTCCT
TTATTGGCTCACATGCCTCCAGGAGAATGCACAGCTCTGCTCCCAAGTAGCGACCTTGAGGAGCGTCCCATTTAT
GAGTGGCCTAGTTTGGGCCCCACAGTCCCAGATGCCCATCAAGATGCCTTGGCTGGCGAAAAGAACCCATCAAAG
GGGTTGCAAAATGCCTTGATCAAGGCCGGCATTGTCACTCTCATTTCCTTGACTGGTGTCTTGGGCTGGTACATA
TCACATCTGGTGGCTAGCTGGGGTGACAAGCACGAGCCCGTCGATCAAGGCCAGGGGACCCCACTCGAGTTCAAC
GTGCTGGGCCAAATATTTGGCTACGTTTGCACCGTCTTTTATACTTGCTCACGTATGCCCCAGCTCATCCTCAAC
TGGCGTCGCAAAACGACAAACGGCCTGAGCATTCTCTTCTTCATGTTTACCTGCCTTGGAAACGTCAACTTTGCC
CTGTCCATTCTCATATACGTCCCCACTTGCGCTGATGCTGTTTGCAAGCCAGGCGAGGCCAGCCAGATATACTGG
CGCTACATCTTGATTAATCTGAGTTGGCTTTCAGGCTGCTTACTGACATTGGCCTTGGATCTATGCATTCTTGCA
CAATACTACGCATATCAGAAACCTAGTGGTGAGAAAGAACAGGCCCAAATAGCTGCCGACTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail