Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|3798
Gene name
LocationContig_299:14244..15197
Strand+
Gene length (bp)953
Transcript length (bp)867
Coding sequence length (bp)867
Protein length (aa) 289

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13862 BCCIP BCCIP 2.5E-64 36 228

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4HZK7|BCP1_GIBZE Protein BCP1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=BCP1 PE=3 SV=1 1 285 1.0E-139
sp|Q2H137|BCP1_CHAGB Protein BCP1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=BCP1 PE=3 SV=1 1 284 6.0E-107
sp|Q7S8R3|BCP1_NEUCR Protein bcp-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=bcp-1 PE=3 SV=1 1 287 8.0E-102
sp|Q4WVS2|BCP1_ASPFU Protein bcp1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=bcp1 PE=3 SV=2 17 286 5.0E-97
sp|Q5AXW5|BCP1_EMENI Protein bcp1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bcp1 PE=3 SV=1 27 286 4.0E-95
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4HZK7|BCP1_GIBZE Protein BCP1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=BCP1 PE=3 SV=1 1 285 1.0E-139
sp|Q2H137|BCP1_CHAGB Protein BCP1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=BCP1 PE=3 SV=1 1 284 6.0E-107
sp|Q7S8R3|BCP1_NEUCR Protein bcp-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=bcp-1 PE=3 SV=1 1 287 8.0E-102
sp|Q4WVS2|BCP1_ASPFU Protein bcp1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=bcp1 PE=3 SV=2 17 286 5.0E-97
sp|Q5AXW5|BCP1_EMENI Protein bcp1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bcp1 PE=3 SV=1 27 286 4.0E-95
sp|Q2U600|BCP1_ASPOR Protein bcp1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=bcp1 PE=3 SV=1 26 286 5.0E-93
sp|Q6C7K5|BCP1_YARLI Protein BCP1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=BCP1 PE=3 SV=1 8 286 2.0E-61
sp|O74907|BCP1_SCHPO Protein bcp1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bcp1 PE=3 SV=2 31 282 3.0E-60
sp|Q6BII5|BCP1_DEBHA Protein BCP1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=BCP1 PE=3 SV=1 15 286 1.0E-53
sp|Q59PE7|BCP1_CANAL Protein BCP1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=BCP1 PE=3 SV=1 37 286 2.0E-46
sp|Q6FY61|BCP1_CANGA Protein BCP1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=BCP1 PE=3 SV=1 1 235 1.0E-34
sp|Q756K9|BCP1_ASHGO Protein BCP1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=BCP1 PE=3 SV=1 15 232 7.0E-31
sp|Q06338|BCP1_YEAST Protein BCP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BCP1 PE=1 SV=1 36 232 2.0E-26
sp|O64885|BCCIP_ARATH Protein BCCIP homolog OS=Arabidopsis thaliana GN=At2g44510 PE=1 SV=2 28 281 1.0E-22
sp|Q2NL37|BCCIP_BOVIN BRCA2 and CDKN1A-interacting protein OS=Bos taurus GN=BCCIP PE=2 SV=1 38 284 3.0E-20
sp|Q9CWI3|BCCIP_MOUSE BRCA2 and CDKN1A-interacting protein OS=Mus musculus GN=Bccip PE=1 SV=1 38 284 1.0E-19
sp|Q4PA45|BCP1_USTMA Protein BCP1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=BCP1 PE=3 SV=1 32 285 2.0E-19
sp|Q9P287|BCCIP_HUMAN BRCA2 and CDKN1A-interacting protein OS=Homo sapiens GN=BCCIP PE=1 SV=1 38 284 8.0E-19
sp|Q6GNI0|BCCIP_XENLA Protein BCCIP homolog OS=Xenopus laevis GN=bccip PE=2 SV=1 37 284 4.0E-17
sp|Q6GL92|BCCIP_XENTR Protein BCCIP homolog OS=Xenopus tropicalis GN=bccip PE=2 SV=1 71 284 9.0E-17
sp|Q5BJJ7|BCCIP_DANRE Protein BCCIP homolog OS=Danio rerio GN=bccip PE=2 SV=1 39 284 3.0E-16
sp|Q9VFR0|BCCIP_DROME Protein BCCIP homolog OS=Drosophila melanogaster GN=CG9286 PE=2 SV=2 49 284 9.0E-14
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4101
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3798 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|1005
Ophiocordyceps camponoti-floridani Ophcf2|03981
Ophiocordyceps camponoti-rufipedis Ophun1|1881
Ophiocordyceps kimflemingae Ophio5|1353
Ophiocordyceps subramaniannii Hirsu2|8299

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|3798
MGNKRSREHGKHVPSSNDVPEAMDGDGSADDEDFNMVDVEFEWFNFDPDIDFHGVKSLLRQLLDVDASLFDMSAL
ANLVLSQPTIGSTVKVDGKATDAYAMLTVLNTLEHRDEASMKPVLEYLVEKASSTDSLSAVAHLINAGSPIGLIL
SERLINVPSEIAPPMYSLLIDEVEAAVEDKEPYEFSHYLIVSKTYSEVESTLHAEHRKRKKAREESSTFYFHPED
EMLHKHASAYGTFSYTKEADAVADSKRAFQEMGIKTMGHMVLIEAGKFAAAVKSINEYLCPGH*
Coding >OphauG2|3798
ATGGGCAACAAGAGGTCGCGAGAGCATGGCAAACATGTTCCGTCCAGCAACGACGTCCCCGAAGCAATGGATGGC
GACGGCAGTGCCGATGACGAGGACTTCAACATGGTCGACGTAGAGTTCGAGTGGTTCAACTTCGACCCAGATATC
GACTTCCACGGCGTCAAGTCGCTCCTGCGCCAGCTCTTGGATGTCGACGCCAGCCTCTTTGACATGTCGGCTCTG
GCCAATCTTGTTCTCTCACAGCCCACCATTGGCTCCACAGTCAAAGTCGACGGCAAGGCAACCGATGCCTACGCC
ATGCTGACCGTGCTCAACACGCTTGAGCATCGTGACGAGGCCTCGATGAAGCCTGTCCTAGAGTACCTAGTGGAA
AAGGCCAGCTCTACCGATTCGCTGTCCGCCGTTGCCCACCTCATCAATGCTGGCAGTCCGATAGGCTTGATCCTG
TCGGAACGTTTAATCAACGTACCTTCCGAGATTGCGCCCCCAATGTACTCACTGCTCATTGACGAAGTCGAGGCG
GCTGTCGAGGACAAGGAGCCATATGAGTTTAGCCACTACCTGATAGTGTCAAAGACGTACAGCGAGGTGGAATCT
ACGCTCCATGCCGAGCATCGCAAACGAAAAAAGGCAAGGGAAGAGTCGTCGACATTCTACTTTCATCCCGAGGAC
GAGATGCTCCACAAGCATGCCTCTGCCTATGGCACCTTTTCATACACCAAGGAGGCGGACGCTGTCGCCGACAGC
AAGCGAGCATTTCAAGAAATGGGCATCAAGACAATGGGGCACATGGTTCTCATCGAGGCGGGCAAATTTGCAGCG
GCGGTAAAGAGTATCAATGAGTACCTGTGTCCGGGGCATTGA
Transcript >OphauG2|3798
ATGGGCAACAAGAGGTCGCGAGAGCATGGCAAACATGTTCCGTCCAGCAACGACGTCCCCGAAGCAATGGATGGC
GACGGCAGTGCCGATGACGAGGACTTCAACATGGTCGACGTAGAGTTCGAGTGGTTCAACTTCGACCCAGATATC
GACTTCCACGGCGTCAAGTCGCTCCTGCGCCAGCTCTTGGATGTCGACGCCAGCCTCTTTGACATGTCGGCTCTG
GCCAATCTTGTTCTCTCACAGCCCACCATTGGCTCCACAGTCAAAGTCGACGGCAAGGCAACCGATGCCTACGCC
ATGCTGACCGTGCTCAACACGCTTGAGCATCGTGACGAGGCCTCGATGAAGCCTGTCCTAGAGTACCTAGTGGAA
AAGGCCAGCTCTACCGATTCGCTGTCCGCCGTTGCCCACCTCATCAATGCTGGCAGTCCGATAGGCTTGATCCTG
TCGGAACGTTTAATCAACGTACCTTCCGAGATTGCGCCCCCAATGTACTCACTGCTCATTGACGAAGTCGAGGCG
GCTGTCGAGGACAAGGAGCCATATGAGTTTAGCCACTACCTGATAGTGTCAAAGACGTACAGCGAGGTGGAATCT
ACGCTCCATGCCGAGCATCGCAAACGAAAAAAGGCAAGGGAAGAGTCGTCGACATTCTACTTTCATCCCGAGGAC
GAGATGCTCCACAAGCATGCCTCTGCCTATGGCACCTTTTCATACACCAAGGAGGCGGACGCTGTCGCCGACAGC
AAGCGAGCATTTCAAGAAATGGGCATCAAGACAATGGGGCACATGGTTCTCATCGAGGCGGGCAAATTTGCAGCG
GCGGTAAAGAGTATCAATGAGTACCTGTGTCCGGGGCATTGA
Gene >OphauG2|3798
ATGGGCAACAAGAGGTCGCGAGAGCATGGCAAACATGTTCCGTCCAGCAACGACGTCCCCGAAGCAATGGATGGC
GACGGCAGTGCCGATGACGAGGTGAGCTCATTCCTTTGTTCCTCTCTCATCATGTCCTTGATAAAGTACTCCCAC
TCCCTAGCCCATGCCGCTAAAACACTCCCCAGGACTTCAACATGGTCGACGTAGAGTTCGAGTGGTTCAACTTCG
ACCCAGATATCGACTTCCACGGCGTCAAGTCGCTCCTGCGCCAGCTCTTGGATGTCGACGCCAGCCTCTTTGACA
TGTCGGCTCTGGCCAATCTTGTTCTCTCACAGCCCACCATTGGCTCCACAGTCAAAGTCGACGGCAAGGCAACCG
ATGCCTACGCCATGCTGACCGTGCTCAACACGCTTGAGCATCGTGACGAGGCCTCGATGAAGCCTGTCCTAGAGT
ACCTAGTGGAAAAGGCCAGCTCTACCGATTCGCTGTCCGCCGTTGCCCACCTCATCAATGCTGGCAGTCCGATAG
GCTTGATCCTGTCGGAACGTTTAATCAACGTACCTTCCGAGATTGCGCCCCCAATGTACTCACTGCTCATTGACG
AAGTCGAGGCGGCTGTCGAGGACAAGGAGCCATATGAGTTTAGCCACTACCTGATAGTGTCAAAGACGTACAGCG
AGGTGGAATCTACGCTCCATGCCGAGCATCGCAAACGAAAAAAGGCAAGGGAAGAGTCGTCGACATTCTACTTTC
ATCCCGAGGACGAGATGCTCCACAAGCATGCCTCTGCCTATGGCACCTTTTCATACACCAAGGAGGCGGACGCTG
TCGCCGACAGCAAGCGAGCATTTCAAGAAATGGGCATCAAGACAATGGGGCACATGGTTCTCATCGAGGCGGGCA
AATTTGCAGCGGCGGTAAAGAGTATCAATGAGTACCTGTGTCCGGGGCATTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail