Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|3794
Gene name
LocationContig_299:5872..6923
Strand-
Gene length (bp)1051
Transcript length (bp)909
Coding sequence length (bp)909
Protein length (aa) 303

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02678 Pirin Pirin 1.9E-29 22 120
PF05726 Pirin_C Pirin C-terminal cupin domain 2.9E-23 177 284

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O00625|PIR_HUMAN Pirin OS=Homo sapiens GN=PIR PE=1 SV=1 1 297 5.0E-85
sp|Q9D711|PIR_MOUSE Pirin OS=Mus musculus GN=Pir PE=1 SV=1 1 297 2.0E-82
sp|Q5M827|PIR_RAT Pirin OS=Rattus norvegicus GN=Pir PE=1 SV=1 1 297 6.0E-81
sp|Q9SEE4|PIRL_SOLLC Pirin-like protein OS=Solanum lycopersicum PE=2 SV=1 1 295 1.0E-80
sp|Q9LPS9|PRNL1_ARATH Pirin-like protein At1g50590 OS=Arabidopsis thaliana GN=At1g50590 PE=2 SV=1 5 301 1.0E-78
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O00625|PIR_HUMAN Pirin OS=Homo sapiens GN=PIR PE=1 SV=1 1 297 5.0E-85
sp|Q9D711|PIR_MOUSE Pirin OS=Mus musculus GN=Pir PE=1 SV=1 1 297 2.0E-82
sp|Q5M827|PIR_RAT Pirin OS=Rattus norvegicus GN=Pir PE=1 SV=1 1 297 6.0E-81
sp|Q9SEE4|PIRL_SOLLC Pirin-like protein OS=Solanum lycopersicum PE=2 SV=1 1 295 1.0E-80
sp|Q9LPS9|PRNL1_ARATH Pirin-like protein At1g50590 OS=Arabidopsis thaliana GN=At1g50590 PE=2 SV=1 5 301 1.0E-78
sp|Q9ZW82|PRNL2_ARATH Pirin-like protein At2g43120 OS=Arabidopsis thaliana GN=At2g43120 PE=2 SV=3 3 295 4.0E-76
sp|Q9LX49|PRN1_ARATH Pirin-1 OS=Arabidopsis thaliana GN=PRN1 PE=1 SV=1 2 290 1.0E-69
sp|Q9LX45|PRNL4_ARATH Putative pirin-like protein At3g59260 OS=Arabidopsis thaliana GN=At3g59260 PE=3 SV=1 38 295 9.0E-69
sp|P58112|Y481_CAUCR Pirin-like protein CC_0481 OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=CC_0481 PE=3 SV=1 5 280 6.0E-51
sp|Q9HZ00|Y3240_PSEAE Putative quercetin 2,3-dioxygenase PA3240 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=PA3240 PE=3 SV=1 17 280 3.0E-46
sp|Q9I163|Y2418_PSEAE Putative quercetin 2,3-dioxygenase PA2418 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=PA2418 PE=3 SV=1 35 281 3.0E-38
sp|Q9KKY1|Y3769_VIBCH Putative quercetin 2,3-dioxygenase VC_A0969 OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=VC_A0969 PE=3 SV=1 1 281 4.0E-38
sp|Q9HLU2|Y133_THEAC Putative quercetin 2,3-dioxygenase Ta0133 OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=Ta0133 PE=3 SV=1 52 280 1.0E-37
sp|P58114|Y3178_CAUCR Pirin-like protein CC_3178 OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=CC_3178 PE=3 SV=1 38 281 2.0E-18
sp|Q9I4D3|Y1205_PSEAE Putative quercetin 2,3-dioxygenase PA1205 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=PA1205 PE=3 SV=1 19 288 4.0E-15
sp|Q9CKD7|Y1685_PASMU Putative quercetin 2,3-dioxygenase PM1685 OS=Pasteurella multocida (strain Pm70) GN=PM1685 PE=3 SV=1 35 134 8.0E-15
sp|Q9I4C8|Y1210_PSEAE Putative quercetin 2,3-dioxygenase PA1210 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=PA1210 PE=3 SV=1 46 207 9.0E-15
sp|P46852|YHHW_ECOLI Quercetin 2,3-dioxygenase OS=Escherichia coli (strain K12) GN=yhhW PE=1 SV=1 36 141 5.0E-14
sp|P58116|YHHW_ECO57 Quercetin 2,3-dioxygenase OS=Escherichia coli O157:H7 GN=yhhW PE=3 SV=1 36 141 5.0E-14
sp|Q9XBR7|Y1337_ZYMMO Putative quercetin 2,3-dioxygenase ZMO1337 OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=ZMO1337 PE=3 SV=1 47 120 7.0E-14
sp|P73623|Y1773_SYNY3 Putative quercetin 2,3-dioxygenase sll1773 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll1773 PE=3 SV=1 35 134 8.0E-14
sp|P65725|Y187_MYCBO Putative quercetin 2,3-dioxygenase Mb0187c OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb0187c PE=3 SV=1 47 215 2.0E-13
sp|P9WI85|Y181_MYCTU Putative quercetin 2,3-dioxygenase Rv0181c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0181c PE=1 SV=1 47 215 2.0E-13
sp|P9WI84|Y181_MYCTO Putative quercetin 2,3-dioxygenase MT0190 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT0190 PE=3 SV=1 47 215 2.0E-13
sp|P58113|Y1473_CAUCR Pirin-like protein CC_1473 OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=CC_1473 PE=3 SV=1 35 121 4.0E-12
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup7030
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3794 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|1009
Ophiocordyceps subramaniannii Hirsu2|4245

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|3794
MSIPRTISKVLLAVEQAEGAGARVRRSIGTSRVPNFSPFLMLDHFSIKPGAGFPDHPHRGQETITYLLDGGVEHE
DFTGNRGSLGPGDLQFMTAGRGIVHAEMPRQNPDGRPNVGLQLWVDLPRNLKDCEPRYRDLRADEVPSINVDDDR
ATIKVISGRSHGVDSVKDLAYTPVWILDITLRPGASVDQPLPAGWSAFAYILQGSVSFGASDALRKVQQFHNVFF
DSNGDFVHVESDQNATEPSRLVLVAGTPLDQEIVQYGPFVLTSKQGVYQALSDYQSCSNGFERAQNWKSEIAKTM
AR*
Coding >OphauG2|3794
ATGTCCATTCCACGCACCATTTCCAAGGTCCTTCTGGCCGTTGAGCAAGCTGAAGGCGCAGGCGCCCGCGTCCGC
CGCTCAATAGGCACCTCGCGCGTTCCCAACTTTTCCCCTTTTCTCATGCTCGACCACTTTTCCATCAAGCCCGGT
GCCGGCTTTCCCGACCACCCCCACAGAGGCCAGGAAACAATAACCTACCTCCTCGATGGCGGCGTCGAGCACGAA
GACTTTACCGGAAATCGCGGCTCTCTCGGCCCAGGTGACCTCCAATTCATGACAGCCGGCCGTGGCATCGTACAC
GCCGAAATGCCTCGCCAAAACCCCGATGGCCGTCCCAACGTCGGCCTCCAACTATGGGTAGACTTGCCTCGTAAT
CTCAAGGATTGTGAGCCGCGATACCGCGATTTGCGCGCCGACGAAGTCCCTTCTATCAACGTTGATGATGACCGC
GCTACCATCAAGGTCATTTCAGGCCGCAGCCATGGCGTCGACTCTGTCAAGGACCTTGCCTACACTCCCGTCTGG
ATTCTCGATATTACTCTTCGCCCTGGCGCCAGTGTTGACCAGCCGTTGCCCGCTGGCTGGTCCGCTTTTGCTTAT
ATCCTCCAAGGCTCCGTGTCTTTTGGCGCCTCAGACGCCCTGCGCAAAGTCCAGCAGTTCCATAACGTCTTCTTC
GACTCAAACGGTGATTTTGTTCATGTCGAGTCGGACCAGAATGCCACTGAGCCTAGTCGTCTAGTCCTAGTTGCC
GGAACTCCCCTTGATCAGGAAATCGTTCAATATGGACCCTTTGTCCTGACCTCCAAACAAGGTGTTTACCAGGCT
CTTTCTGATTACCAATCTTGCTCCAACGGATTTGAGCGTGCTCAAAATTGGAAGAGCGAGATCGCCAAGACAATG
GCCCGTTAG
Transcript >OphauG2|3794
ATGTCCATTCCACGCACCATTTCCAAGGTCCTTCTGGCCGTTGAGCAAGCTGAAGGCGCAGGCGCCCGCGTCCGC
CGCTCAATAGGCACCTCGCGCGTTCCCAACTTTTCCCCTTTTCTCATGCTCGACCACTTTTCCATCAAGCCCGGT
GCCGGCTTTCCCGACCACCCCCACAGAGGCCAGGAAACAATAACCTACCTCCTCGATGGCGGCGTCGAGCACGAA
GACTTTACCGGAAATCGCGGCTCTCTCGGCCCAGGTGACCTCCAATTCATGACAGCCGGCCGTGGCATCGTACAC
GCCGAAATGCCTCGCCAAAACCCCGATGGCCGTCCCAACGTCGGCCTCCAACTATGGGTAGACTTGCCTCGTAAT
CTCAAGGATTGTGAGCCGCGATACCGCGATTTGCGCGCCGACGAAGTCCCTTCTATCAACGTTGATGATGACCGC
GCTACCATCAAGGTCATTTCAGGCCGCAGCCATGGCGTCGACTCTGTCAAGGACCTTGCCTACACTCCCGTCTGG
ATTCTCGATATTACTCTTCGCCCTGGCGCCAGTGTTGACCAGCCGTTGCCCGCTGGCTGGTCCGCTTTTGCTTAT
ATCCTCCAAGGCTCCGTGTCTTTTGGCGCCTCAGACGCCCTGCGCAAAGTCCAGCAGTTCCATAACGTCTTCTTC
GACTCAAACGGTGATTTTGTTCATGTCGAGTCGGACCAGAATGCCACTGAGCCTAGTCGTCTAGTCCTAGTTGCC
GGAACTCCCCTTGATCAGGAAATCGTTCAATATGGACCCTTTGTCCTGACCTCCAAACAAGGTGTTTACCAGGCT
CTTTCTGATTACCAATCTTGCTCCAACGGATTTGAGCGTGCTCAAAATTGGAAGAGCGAGATCGCCAAGACAATG
GCCCGTTAG
Gene >OphauG2|3794
ATGTCCATTCCACGCACCATTTCCAAGGTCCTTCTGGCCGTTGAGCAAGCTGAAGGCGCAGGCGCCCGCGTCCGC
CGCTCAATAGGCACCTCGCGCGTTCCCAACTTTTCCCCTTTTCTCATGCTCGACCACTTTTCCATCAAGCCCGGT
GCCGGCTTTCCCGACCAGTAAGCAACCCTTGCCTCTTCTTCAAAATATTTCCCGAGCCTCACCTTTTCTTGCTTC
CCACAGCCCCCACAGAGGCCAGGAAACAATAACCTACCTCCTCGATGGCGGCGTCGAGCACGAAGACTTTACCGG
AAATCGCGGCTCTCTCGGCCCAGGTGACCTCCAATTCATGACAGCCGGCCGTGGCATCGTACACGCCGAAATGCC
TCGCCAAAACCCCGATGGCCGTCCCAACGTCGGCCTCCAACTATGGGTAGACTTGCCTCGTAATCTCAAGGATTG
TGAGCCGCGATACCGCGATTTGCGCGCCGACGAAGTCCCTTCTATCAACGTTGATGATGACCGCGCTACCATCAA
GGTCATTTCAGGCCGCAGCCATGGCGTCGACTCTGTCAAGGACCTTGCCTACACTCCCGTCTGGATTCTCGATAT
TACTCTTCGCCCTGGCGCCAGTGTTGACCAGCCGTTGCCCGCTGGCTGGTCCGCTTTTGCTTATATCCTCCAAGG
CTCCGTGTCTTTTGGCGCCTCAGACGCCCTGCGCAAAGTCCAGCAGTTCCATAACGTCTTCTTCGACTCAAACGG
TGATTTTGTTCATGTCGAGTCGGACCAGAATGCCACTGAGCCTAGTCGTCTAGGTAAGACCCCCCCCCCCTTATT
GCTACATTTTCCTTCGACTTTGATTCTCTAGCTGACTCTGTCCATTTGAATACTAGTCCTAGTTGCCGGAACTCC
CCTTGATCAGGAAATCGTTCAATATGGACCCTTTGTCCTGACCTCCAAACAAGGTGTTTACCAGGCTCTTTCTGA
TTACCAATCTTGCTCCAACGGATTTGAGCGTGCTCAAAATTGGAAGAGCGAGATCGCCAAGACAATGGCCCGTTA
G

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail