Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|3791
Gene name
LocationContig_298:7918..9226
Strand-
Gene length (bp)1308
Transcript length (bp)1308
Coding sequence length (bp)1308
Protein length (aa) 436

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14388 DUF4419 Domain of unknown function (DUF4419) 1.1E-94 86 390

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q5UQ60|YL662_MIMIV Uncharacterized protein L662 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L662 PE=4 SV=1 95 359 1.0E-14

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|3791
MTRLSLLAAVILSAMAAAEMVVKVSNVAPVSLQTQGLVASSKELLEQSAPEEFPAGNTVNVIASSWDQLEPNDLA
ISKGKLYASSDSFVRGAVDAWAHHQQLILRPDVIWFEILAQLNLYVAKHAEDLRHLFVDFQGKKEIVVRELTWQR
VVDAFRGEIQSRVKTPWLRDWITPGFSTSTANDNTTASVLMMGMMQQYFQFTGGIICGLPAVRLQGRRDDWHKLL
VKLDRLHEFGGEPAQYARNLRPILQRFVKTWDEPNSEATRAFWKQIVRADRVMACGRGPVEYDISGWITGFIHWT
ASGEVRARPLPPGVDETRDLTTLDGVKYYPEGLDSLPVGYAKAPFKILDYPQPGAETKGAVLAGNIGIAKAEPGT
MAPEAVSQPLSAWFLYGPVQDDVSANPSRGQVGNFSELERIFQGIESSCPAKQGGKEWSG*
Coding >OphauG2|3791
ATGACGCGACTGTCGTTGCTCGCCGCCGTCATCCTCTCGGCCATGGCGGCCGCCGAGATGGTGGTCAAGGTCAGC
AATGTCGCGCCGGTGTCGCTGCAGACCCAGGGCCTCGTGGCGTCGTCCAAGGAGCTCCTTGAACAGAGCGCCCCC
GAGGAGTTCCCCGCCGGAAACACAGTCAACGTGATTGCCTCTTCGTGGGACCAACTCGAGCCCAACGACCTGGCC
ATTAGCAAGGGCAAGCTCTATGCCTCGTCAGACAGCTTTGTACGCGGCGCCGTGGACGCTTGGGCGCACCACCAG
CAGCTCATCTTGCGACCCGACGTCATCTGGTTTGAGATTCTGGCCCAGCTCAACCTCTACGTCGCCAAGCACGCC
GAGGACCTGCGCCACCTCTTTGTCGACTTTCAGGGCAAGAAGGAAATCGTGGTACGCGAACTGACGTGGCAGCGC
GTCGTCGACGCCTTTCGCGGCGAGATTCAGTCGCGCGTCAAGACGCCCTGGCTGCGAGACTGGATCACGCCCGGC
TTCAGCACCAGCACGGCAAACGACAACACGACGGCGTCGGTGCTCATGATGGGCATGATGCAGCAGTACTTCCAG
TTCACAGGCGGCATCATCTGCGGGCTGCCGGCGGTGCGTCTACAGGGCCGACGCGACGACTGGCACAAGCTGCTC
GTCAAGCTGGACCGGCTGCACGAGTTTGGCGGAGAGCCAGCACAGTATGCCCGCAACCTCAGGCCCATCCTACAG
CGCTTTGTCAAGACGTGGGACGAGCCGAATAGTGAGGCGACGCGCGCCTTTTGGAAGCAGATTGTGCGCGCCGAC
CGCGTCATGGCCTGTGGTAGAGGGCCGGTCGAGTACGACATTTCGGGCTGGATCACGGGCTTCATACACTGGACT
GCCAGCGGCGAGGTGCGCGCGCGGCCGCTGCCCCCGGGAGTCGACGAGACACGCGACCTGACCACGCTCGACGGC
GTCAAGTATTATCCCGAGGGCCTCGATAGTTTGCCCGTCGGATATGCCAAGGCGCCCTTTAAGATTCTCGACTAC
CCGCAGCCCGGAGCGGAGACCAAGGGCGCTGTCCTGGCCGGCAACATTGGAATTGCAAAGGCCGAGCCTGGCACC
ATGGCCCCCGAGGCCGTTTCGCAGCCGCTGAGCGCGTGGTTCCTGTATGGGCCGGTGCAAGACGACGTGTCGGCC
AATCCGAGCCGGGGCCAGGTTGGCAATTTCTCGGAGCTGGAGCGCATTTTTCAAGGCATCGAGTCGAGCTGTCCT
GCCAAGCAAGGGGGCAAGGAATGGTCTGGATAG
Transcript >OphauG2|3791
ATGACGCGACTGTCGTTGCTCGCCGCCGTCATCCTCTCGGCCATGGCGGCCGCCGAGATGGTGGTCAAGGTCAGC
AATGTCGCGCCGGTGTCGCTGCAGACCCAGGGCCTCGTGGCGTCGTCCAAGGAGCTCCTTGAACAGAGCGCCCCC
GAGGAGTTCCCCGCCGGAAACACAGTCAACGTGATTGCCTCTTCGTGGGACCAACTCGAGCCCAACGACCTGGCC
ATTAGCAAGGGCAAGCTCTATGCCTCGTCAGACAGCTTTGTACGCGGCGCCGTGGACGCTTGGGCGCACCACCAG
CAGCTCATCTTGCGACCCGACGTCATCTGGTTTGAGATTCTGGCCCAGCTCAACCTCTACGTCGCCAAGCACGCC
GAGGACCTGCGCCACCTCTTTGTCGACTTTCAGGGCAAGAAGGAAATCGTGGTACGCGAACTGACGTGGCAGCGC
GTCGTCGACGCCTTTCGCGGCGAGATTCAGTCGCGCGTCAAGACGCCCTGGCTGCGAGACTGGATCACGCCCGGC
TTCAGCACCAGCACGGCAAACGACAACACGACGGCGTCGGTGCTCATGATGGGCATGATGCAGCAGTACTTCCAG
TTCACAGGCGGCATCATCTGCGGGCTGCCGGCGGTGCGTCTACAGGGCCGACGCGACGACTGGCACAAGCTGCTC
GTCAAGCTGGACCGGCTGCACGAGTTTGGCGGAGAGCCAGCACAGTATGCCCGCAACCTCAGGCCCATCCTACAG
CGCTTTGTCAAGACGTGGGACGAGCCGAATAGTGAGGCGACGCGCGCCTTTTGGAAGCAGATTGTGCGCGCCGAC
CGCGTCATGGCCTGTGGTAGAGGGCCGGTCGAGTACGACATTTCGGGCTGGATCACGGGCTTCATACACTGGACT
GCCAGCGGCGAGGTGCGCGCGCGGCCGCTGCCCCCGGGAGTCGACGAGACACGCGACCTGACCACGCTCGACGGC
GTCAAGTATTATCCCGAGGGCCTCGATAGTTTGCCCGTCGGATATGCCAAGGCGCCCTTTAAGATTCTCGACTAC
CCGCAGCCCGGAGCGGAGACCAAGGGCGCTGTCCTGGCCGGCAACATTGGAATTGCAAAGGCCGAGCCTGGCACC
ATGGCCCCCGAGGCCGTTTCGCAGCCGCTGAGCGCGTGGTTCCTGTATGGGCCGGTGCAAGACGACGTGTCGGCC
AATCCGAGCCGGGGCCAGGTTGGCAATTTCTCGGAGCTGGAGCGCATTTTTCAAGGCATCGAGTCGAGCTGTCCT
GCCAAGCAAGGGGGCAAGGAATGGTCTGGATAG
Gene >OphauG2|3791
ATGACGCGACTGTCGTTGCTCGCCGCCGTCATCCTCTCGGCCATGGCGGCCGCCGAGATGGTGGTCAAGGTCAGC
AATGTCGCGCCGGTGTCGCTGCAGACCCAGGGCCTCGTGGCGTCGTCCAAGGAGCTCCTTGAACAGAGCGCCCCC
GAGGAGTTCCCCGCCGGAAACACAGTCAACGTGATTGCCTCTTCGTGGGACCAACTCGAGCCCAACGACCTGGCC
ATTAGCAAGGGCAAGCTCTATGCCTCGTCAGACAGCTTTGTACGCGGCGCCGTGGACGCTTGGGCGCACCACCAG
CAGCTCATCTTGCGACCCGACGTCATCTGGTTTGAGATTCTGGCCCAGCTCAACCTCTACGTCGCCAAGCACGCC
GAGGACCTGCGCCACCTCTTTGTCGACTTTCAGGGCAAGAAGGAAATCGTGGTACGCGAACTGACGTGGCAGCGC
GTCGTCGACGCCTTTCGCGGCGAGATTCAGTCGCGCGTCAAGACGCCCTGGCTGCGAGACTGGATCACGCCCGGC
TTCAGCACCAGCACGGCAAACGACAACACGACGGCGTCGGTGCTCATGATGGGCATGATGCAGCAGTACTTCCAG
TTCACAGGCGGCATCATCTGCGGGCTGCCGGCGGTGCGTCTACAGGGCCGACGCGACGACTGGCACAAGCTGCTC
GTCAAGCTGGACCGGCTGCACGAGTTTGGCGGAGAGCCAGCACAGTATGCCCGCAACCTCAGGCCCATCCTACAG
CGCTTTGTCAAGACGTGGGACGAGCCGAATAGTGAGGCGACGCGCGCCTTTTGGAAGCAGATTGTGCGCGCCGAC
CGCGTCATGGCCTGTGGTAGAGGGCCGGTCGAGTACGACATTTCGGGCTGGATCACGGGCTTCATACACTGGACT
GCCAGCGGCGAGGTGCGCGCGCGGCCGCTGCCCCCGGGAGTCGACGAGACACGCGACCTGACCACGCTCGACGGC
GTCAAGTATTATCCCGAGGGCCTCGATAGTTTGCCCGTCGGATATGCCAAGGCGCCCTTTAAGATTCTCGACTAC
CCGCAGCCCGGAGCGGAGACCAAGGGCGCTGTCCTGGCCGGCAACATTGGAATTGCAAAGGCCGAGCCTGGCACC
ATGGCCCCCGAGGCCGTTTCGCAGCCGCTGAGCGCGTGGTTCCTGTATGGGCCGGTGCAAGACGACGTGTCGGCC
AATCCGAGCCGGGGCCAGGTTGGCAATTTCTCGGAGCTGGAGCGCATTTTTCAAGGCATCGAGTCGAGCTGTCCT
GCCAAGCAAGGGGGCAAGGAATGGTCTGGATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail