Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|3779
Gene name
LocationContig_297:5278..6076
Strand-
Gene length (bp)798
Transcript length (bp)798
Coding sequence length (bp)798
Protein length (aa) 266

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01871 AMMECR1 AMMECR1 9.7E-47 88 245

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9ZVJ2|AMERL_ARATH Uncharacterized protein At2g38710 OS=Arabidopsis thaliana GN=At2g38710 PE=2 SV=1 101 253 2.0E-42
sp|Q22004|AMERL_CAEEL Uncharacterized protein R166.3 OS=Caenorhabditis elegans GN=R166.3 PE=3 SV=1 101 257 4.0E-39
sp|Q9VCF0|Y5902_DROME Uncharacterized protein CG5902 OS=Drosophila melanogaster GN=CG5902 PE=2 SV=1 92 258 1.0E-38
sp|Q9JHT5|AMMR1_MOUSE AMME syndrome candidate gene 1 protein homolog OS=Mus musculus GN=Ammecr1 PE=2 SV=1 101 253 6.0E-37
sp|Q5RAS7|AMMR1_PONAB AMME syndrome candidate gene 1 protein homolog OS=Pongo abelii GN=AMMECR1 PE=2 SV=1 101 253 6.0E-37
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9ZVJ2|AMERL_ARATH Uncharacterized protein At2g38710 OS=Arabidopsis thaliana GN=At2g38710 PE=2 SV=1 101 253 2.0E-42
sp|Q22004|AMERL_CAEEL Uncharacterized protein R166.3 OS=Caenorhabditis elegans GN=R166.3 PE=3 SV=1 101 257 4.0E-39
sp|Q9VCF0|Y5902_DROME Uncharacterized protein CG5902 OS=Drosophila melanogaster GN=CG5902 PE=2 SV=1 92 258 1.0E-38
sp|Q9JHT5|AMMR1_MOUSE AMME syndrome candidate gene 1 protein homolog OS=Mus musculus GN=Ammecr1 PE=2 SV=1 101 253 6.0E-37
sp|Q5RAS7|AMMR1_PONAB AMME syndrome candidate gene 1 protein homolog OS=Pongo abelii GN=AMMECR1 PE=2 SV=1 101 253 6.0E-37
sp|Q9Y4X0|AMMR1_HUMAN AMME syndrome candidate gene 1 protein OS=Homo sapiens GN=AMMECR1 PE=1 SV=1 101 253 6.0E-37
sp|Q8JZZ6|AMERL_MOUSE AMMECR1-like protein OS=Mus musculus GN=Ammecr1l PE=1 SV=1 101 253 8.0E-37
sp|Q5RDQ3|AMERL_PONAB AMMECR1-like protein OS=Pongo abelii GN=AMMECR1L PE=2 SV=1 101 253 8.0E-37
sp|Q6DCA0|AMERL_HUMAN AMMECR1-like protein OS=Homo sapiens GN=AMMECR1L PE=1 SV=1 101 253 8.0E-37
sp|Q9P6M2|YKQ3_SCHPO Uncharacterized protein C688.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC688.03c PE=3 SV=2 99 249 3.0E-36
sp|Q12012|YO289_YEAST Uncharacterized protein YOR289W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOR289W PE=1 SV=1 102 255 3.0E-29
sp|Q9URS8|Y464_KLULA Uncharacterized protein KLLA0D02464g OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=KLLA0D02464g PE=3 SV=1 100 245 2.0E-28
sp|Q4JAL7|Y792_SULAC Protein Saci_0792 OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=Saci_0792 PE=3 SV=1 103 244 6.0E-14
sp|Q976G0|Y229_SULTO Protein STK_02290 OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=STK_02290 PE=1 SV=1 103 243 1.0E-11
sp|O67431|Y1444_AQUAE Protein aq_1444 OS=Aquifex aeolicus (strain VF5) GN=aq_1444 PE=3 SV=1 105 246 2.0E-11
sp|A3DP40|Y1309_STAMF Protein Smar_1309 OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1) GN=Smar_1309 PE=3 SV=1 103 244 3.0E-11
sp|Q9HLJ2|Y236_THEAC Protein Ta0236 OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=Ta0236 PE=3 SV=1 44 242 5.0E-11
sp|O26945|Y857_METTH Protein MTH_857 OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=MTH_857 PE=3 SV=1 105 244 9.0E-11
sp|Q58220|Y810_METJA Protein MJ0810 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0810 PE=3 SV=2 106 244 1.0E-10
sp|O57770|Y010_PYRHO Protein PH0010 OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=PH0010 PE=1 SV=1 102 250 5.0E-10
sp|Q978N1|Y1384_THEVO Protein TV1384 OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=TV1384 PE=3 SV=1 102 242 1.0E-09
sp|Q9V2R5|Y010_PYRAB Protein PYRAB00100 OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=PYRAB00100 PE=3 SV=1 102 250 1.0E-09
sp|Q5JFK7|Y174_THEKO Protein TK0174 OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=TK0174 PE=3 SV=1 102 250 2.0E-09
sp|B6YW91|Y1965_THEON Protein TON_1965 OS=Thermococcus onnurineus (strain NA1) GN=TON_1965 PE=3 SV=1 102 250 2.0E-09
sp|Q8TZL1|Y1979_PYRFU Protein PF1979 OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=PF1979 PE=3 SV=1 102 250 6.0E-09
sp|Q46BJ4|Y1807_METBF Protein Mbar_A1807 OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=Mbar_A1807 PE=3 SV=1 117 225 2.0E-08
sp|A6UTA8|Y138_META3 Protein Maeo_0138 OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=Maeo_0138 PE=3 SV=1 116 240 2.0E-08
sp|C5A6U0|Y1450_THEGJ Protein TGAM_1450 OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=TGAM_1450 PE=3 SV=1 102 250 3.0E-08
sp|Q9YD56|Y1056_AERPE Protein APE_1056.1 OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=APE_1056.1 PE=3 SV=2 103 216 3.0E-08
sp|A8MBB6|Y360_CALMQ Protein Cmaq_0360 OS=Caldivirga maquilingensis (strain ATCC 700844 / DSM 13496 / JCM 10307 / IC-167) GN=Cmaq_0360 PE=3 SV=1 102 243 7.0E-08
sp|Q8TK33|Y3591_METAC Protein MA_3591 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=MA_3591 PE=3 SV=1 117 255 1.0E-07
sp|C3NF81|Y855_SULIN Protein YN1551_0855 OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=YN1551_0855 PE=3 SV=1 104 243 2.0E-07
sp|C3MJ10|Y2104_SULIL Protein LS215_2104 OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=LS215_2104 PE=3 SV=1 104 243 2.0E-07
sp|C3N830|Y2063_SULIY Protein YG5714_2063 OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=YG5714_2063 PE=3 SV=1 104 243 2.0E-07
sp|C3MZQ7|Y2019_SULIA Protein M1627_2019 OS=Sulfolobus islandicus (strain M.16.27) GN=M1627_2019 PE=3 SV=1 104 243 2.0E-07
sp|C4KIY8|Y1949_SULIK Protein M164_1949 OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=M164_1949 PE=3 SV=1 104 243 2.0E-07
sp|C3MYC8|Y1941_SULIM Protein M1425_1941 OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=M1425_1941 PE=3 SV=1 104 243 2.0E-07
sp|Q74M72|Y441_NANEQ Protein NEQ441 OS=Nanoarchaeum equitans (strain Kin4-M) GN=NEQ441 PE=3 SV=1 103 244 1.0E-06
sp|Q980T4|Y193_SULSO Protein SSO0193 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=SSO0193 PE=3 SV=1 104 243 8.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|3779
MASAEHCLMCFDALQIRLGDKRKPRSLDALQASWAAYLSSSLPASPDPSVPLKDPALRRVAASSSSSSSSSSLAS
SLPSPAAASTPATSTSSLPLGPTSAPLFVTWNTMEDDGDTSLRGCIGTFEPQPLSTGIADYAVTSAMMDARFSPI
RKSELPSLQVAVTLLTDFEELTDPHDWEIGTHGIRLSFHDRARRYGSTYLPDVAAEQGWTKDETLFSLVRKAGWI
GSRSRWKDLELKVTRYQGKKHCMEYSVYKKWKDWATANNQ*
Coding >OphauG2|3779
ATGGCGTCCGCCGAGCACTGTCTCATGTGCTTTGATGCCCTCCAAATTCGTCTCGGTGACAAGCGCAAGCCCCGC
TCCCTCGACGCCCTCCAGGCCTCGTGGGCTGCCTATCTGAGCTCCAGTCTTCCTGCCAGCCCAGACCCGTCTGTC
CCGCTCAAAGACCCTGCTCTGCGCCGCGTTGCTGCCTCGTCGTCTTCCTCGTCTTCCTCTTCCTCACTGGCCTCG
TCGCTACCTTCGCCCGCCGCTGCCTCGACGCCAGCCACCTCGACCTCGTCTCTGCCTCTGGGCCCAACCTCTGCC
CCGCTCTTCGTCACATGGAACACCATGGAGGATGACGGCGACACGTCGCTGCGCGGATGCATCGGCACCTTTGAG
CCCCAGCCACTGTCCACTGGCATTGCAGACTACGCCGTTACTTCTGCCATGATGGATGCTCGCTTCAGCCCTATC
CGCAAGTCGGAGCTCCCCAGCCTGCAGGTTGCCGTGACCCTGCTCACCGACTTTGAGGAGCTCACCGATCCCCAT
GACTGGGAGATTGGCACCCACGGCATTCGTCTCTCTTTCCATGACCGTGCCCGCCGCTACGGCTCCACCTATCTT
CCAGACGTAGCGGCTGAGCAGGGCTGGACCAAGGACGAGACGCTCTTTAGCCTTGTTCGCAAGGCTGGCTGGATA
GGCAGCCGCTCGCGTTGGAAGGACTTGGAGCTCAAAGTCACGCGCTACCAGGGCAAGAAGCATTGCATGGAGTAC
TCGGTGTACAAGAAGTGGAAGGACTGGGCCACAGCCAACAACCAATAG
Transcript >OphauG2|3779
ATGGCGTCCGCCGAGCACTGTCTCATGTGCTTTGATGCCCTCCAAATTCGTCTCGGTGACAAGCGCAAGCCCCGC
TCCCTCGACGCCCTCCAGGCCTCGTGGGCTGCCTATCTGAGCTCCAGTCTTCCTGCCAGCCCAGACCCGTCTGTC
CCGCTCAAAGACCCTGCTCTGCGCCGCGTTGCTGCCTCGTCGTCTTCCTCGTCTTCCTCTTCCTCACTGGCCTCG
TCGCTACCTTCGCCCGCCGCTGCCTCGACGCCAGCCACCTCGACCTCGTCTCTGCCTCTGGGCCCAACCTCTGCC
CCGCTCTTCGTCACATGGAACACCATGGAGGATGACGGCGACACGTCGCTGCGCGGATGCATCGGCACCTTTGAG
CCCCAGCCACTGTCCACTGGCATTGCAGACTACGCCGTTACTTCTGCCATGATGGATGCTCGCTTCAGCCCTATC
CGCAAGTCGGAGCTCCCCAGCCTGCAGGTTGCCGTGACCCTGCTCACCGACTTTGAGGAGCTCACCGATCCCCAT
GACTGGGAGATTGGCACCCACGGCATTCGTCTCTCTTTCCATGACCGTGCCCGCCGCTACGGCTCCACCTATCTT
CCAGACGTAGCGGCTGAGCAGGGCTGGACCAAGGACGAGACGCTCTTTAGCCTTGTTCGCAAGGCTGGCTGGATA
GGCAGCCGCTCGCGTTGGAAGGACTTGGAGCTCAAAGTCACGCGCTACCAGGGCAAGAAGCATTGCATGGAGTAC
TCGGTGTACAAGAAGTGGAAGGACTGGGCCACAGCCAACAACCAATAG
Gene >OphauG2|3779
ATGGCGTCCGCCGAGCACTGTCTCATGTGCTTTGATGCCCTCCAAATTCGTCTCGGTGACAAGCGCAAGCCCCGC
TCCCTCGACGCCCTCCAGGCCTCGTGGGCTGCCTATCTGAGCTCCAGTCTTCCTGCCAGCCCAGACCCGTCTGTC
CCGCTCAAAGACCCTGCTCTGCGCCGCGTTGCTGCCTCGTCGTCTTCCTCGTCTTCCTCTTCCTCACTGGCCTCG
TCGCTACCTTCGCCCGCCGCTGCCTCGACGCCAGCCACCTCGACCTCGTCTCTGCCTCTGGGCCCAACCTCTGCC
CCGCTCTTCGTCACATGGAACACCATGGAGGATGACGGCGACACGTCGCTGCGCGGATGCATCGGCACCTTTGAG
CCCCAGCCACTGTCCACTGGCATTGCAGACTACGCCGTTACTTCTGCCATGATGGATGCTCGCTTCAGCCCTATC
CGCAAGTCGGAGCTCCCCAGCCTGCAGGTTGCCGTGACCCTGCTCACCGACTTTGAGGAGCTCACCGATCCCCAT
GACTGGGAGATTGGCACCCACGGCATTCGTCTCTCTTTCCATGACCGTGCCCGCCGCTACGGCTCCACCTATCTT
CCAGACGTAGCGGCTGAGCAGGGCTGGACCAAGGACGAGACGCTCTTTAGCCTTGTTCGCAAGGCTGGCTGGATA
GGCAGCCGCTCGCGTTGGAAGGACTTGGAGCTCAAAGTCACGCGCTACCAGGGCAAGAAGCATTGCATGGAGTAC
TCGGTGTACAAGAAGTGGAAGGACTGGGCCACAGCCAACAACCAATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail