Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|3767
Gene name
LocationContig_296:119..527
Strand+
Gene length (bp)408
Transcript length (bp)408
Coding sequence length (bp)408
Protein length (aa) 136

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00590 TP_methylase Tetrapyrrole (Corrin/Porphyrin) Methylases 1.7E-08 7 63

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P36150|SUMT_YEAST Uroporphyrinogen-III C-methyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MET1 PE=1 SV=1 1 87 1.0E-19
sp|O74468|SUMT_SCHPO Probable uroporphyrinogen-III C-methyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1739.06c PE=2 SV=1 1 91 5.0E-16
sp|Q58375|SUMT_METJA Uroporphyrinogen-III C-methyltransferase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=cobA PE=3 SV=2 7 76 3.0E-07
sp|P37725|SUMT_PSEFL Uroporphyrinogen-III C-methyltransferase OS=Pseudomonas fluorescens GN=cobA PE=3 SV=1 12 86 3.0E-06

GO

GO Term Description Terminal node
GO:0008168 methyltransferase activity Yes
GO:0003674 molecular_function No
GO:0016740 transferase activity No
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0003824 catalytic activity No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5819
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3767 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|1496
Ophiocordyceps camponoti-floridani Ophcf2|00997
Ophiocordyceps camponoti-rufipedis Ophun1|7370
Ophiocordyceps kimflemingae Ophio5|7925

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|3767
MPPPPEHLASRTLVYLMALHRIHQLVPQLTAPPASWPPDTPCAVIERATCPDQRIIRSSLAHVVAAVQAIGSRPP
GLLVVGAACTALAHTAPHAVHEKYWSVQEGLNPADLPLSIPLPWLNSAMHDGPVTWTSSH*
Coding >OphauG2|3767
ATGCCCCCGCCGCCAGAACACCTCGCCTCCCGCACCCTCGTCTACCTCATGGCCCTGCATCGCATCCACCAGCTT
GTCCCCCAGCTCACTGCCCCGCCTGCCTCCTGGCCCCCCGATACCCCTTGCGCCGTCATTGAGCGCGCCACTTGT
CCCGACCAGCGCATCATCCGCTCATCCCTCGCCCACGTCGTCGCCGCCGTCCAAGCAATCGGCAGCAGACCCCCA
GGCCTCCTCGTCGTCGGCGCCGCCTGCACCGCCCTTGCCCACACTGCCCCCCACGCCGTCCACGAAAAATACTGG
TCTGTCCAAGAGGGCCTGAACCCCGCCGACTTGCCCCTCTCCATCCCCTTGCCGTGGCTAAACTCGGCCATGCAT
GACGGCCCTGTGACTTGGACCTCCTCGCATTGA
Transcript >OphauG2|3767
ATGCCCCCGCCGCCAGAACACCTCGCCTCCCGCACCCTCGTCTACCTCATGGCCCTGCATCGCATCCACCAGCTT
GTCCCCCAGCTCACTGCCCCGCCTGCCTCCTGGCCCCCCGATACCCCTTGCGCCGTCATTGAGCGCGCCACTTGT
CCCGACCAGCGCATCATCCGCTCATCCCTCGCCCACGTCGTCGCCGCCGTCCAAGCAATCGGCAGCAGACCCCCA
GGCCTCCTCGTCGTCGGCGCCGCCTGCACCGCCCTTGCCCACACTGCCCCCCACGCCGTCCACGAAAAATACTGG
TCTGTCCAAGAGGGCCTGAACCCCGCCGACTTGCCCCTCTCCATCCCCTTGCCGTGGCTAAACTCGGCCATGCAT
GACGGCCCTGTGACTTGGACCTCCTCGCATTGA
Gene >OphauG2|3767
ATGCCCCCGCCGCCAGAACACCTCGCCTCCCGCACCCTCGTCTACCTCATGGCCCTGCATCGCATCCACCAGCTT
GTCCCCCAGCTCACTGCCCCGCCTGCCTCCTGGCCCCCCGATACCCCTTGCGCCGTCATTGAGCGCGCCACTTGT
CCCGACCAGCGCATCATCCGCTCATCCCTCGCCCACGTCGTCGCCGCCGTCCAAGCAATCGGCAGCAGACCCCCA
GGCCTCCTCGTCGTCGGCGCCGCCTGCACCGCCCTTGCCCACACTGCCCCCCACGCCGTCCACGAAAAATACTGG
TCTGTCCAAGAGGGCCTGAACCCCGCCGACTTGCCCCTCTCCATCCCCTTGCCGTGGCTAAACTCGGCCATGCAT
GACGGCCCTGTGACTTGGACCTCCTCGCATTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail