Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|3750
Gene name
LocationContig_293:6183..7685
Strand-
Gene length (bp)1502
Transcript length (bp)1389
Coding sequence length (bp)1389
Protein length (aa) 463

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03943 TAP_C TAP C-terminal domain 1.3E-15 416 461
PF02136 NTF2 Nuclear transport factor 2 (NTF2) domain 4.0E-04 215 387

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y8G3|MEX67_SCHPO mRNA export factor mex67 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mex67 PE=1 SV=1 199 462 3.0E-22
sp|P84149|MEX67_CANAL mRNA export factor MEX67 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MEX67 PE=1 SV=2 210 462 2.0E-15
sp|Q9UBU9|NXF1_HUMAN Nuclear RNA export factor 1 OS=Homo sapiens GN=NXF1 PE=1 SV=1 160 461 9.0E-13
sp|Q99JX7|NXF1_MOUSE Nuclear RNA export factor 1 OS=Mus musculus GN=Nxf1 PE=1 SV=3 153 461 1.0E-12
sp|O88984|NXF1_RAT Nuclear RNA export factor 1 OS=Rattus norvegicus GN=Nxf1 PE=2 SV=1 198 461 2.0E-12
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y8G3|MEX67_SCHPO mRNA export factor mex67 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mex67 PE=1 SV=1 199 462 3.0E-22
sp|P84149|MEX67_CANAL mRNA export factor MEX67 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MEX67 PE=1 SV=2 210 462 2.0E-15
sp|Q9UBU9|NXF1_HUMAN Nuclear RNA export factor 1 OS=Homo sapiens GN=NXF1 PE=1 SV=1 160 461 9.0E-13
sp|Q99JX7|NXF1_MOUSE Nuclear RNA export factor 1 OS=Mus musculus GN=Nxf1 PE=1 SV=3 153 461 1.0E-12
sp|O88984|NXF1_RAT Nuclear RNA export factor 1 OS=Rattus norvegicus GN=Nxf1 PE=2 SV=1 198 461 2.0E-12
sp|Q5R752|NXF1_PONAB Nuclear RNA export factor 1 OS=Pongo abelii GN=NXF1 PE=3 SV=1 188 461 3.0E-12
sp|P58797|NXF1_COTJA Nuclear RNA export factor 1 OS=Coturnix coturnix japonica GN=NXF1 PE=1 SV=1 188 461 3.0E-12
sp|Q1RMS5|NXF1_BOVIN Nuclear RNA export factor 1 OS=Bos taurus GN=NXF1 PE=2 SV=1 160 461 1.0E-11
sp|Q99257|MEX67_YEAST mRNA export factor MEX67 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MEX67 PE=1 SV=1 194 462 5.0E-08
sp|Q9XVS7|NXF1_CAEEL Nuclear RNA export factor 1 OS=Caenorhabditis elegans GN=nxf-1 PE=1 SV=1 217 462 6.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0051028 mRNA transport Yes
GO:0005634 nucleus Yes
GO:0015931 nucleobase-containing compound transport No
GO:0051236 establishment of RNA localization No
GO:0005575 cellular_component No
GO:0110165 cellular anatomical entity No
GO:0008150 biological_process No
GO:0050657 nucleic acid transport No
GO:0043226 organelle No
GO:0071702 organic substance transport No
GO:0071705 nitrogen compound transport No
GO:0051234 establishment of localization No
GO:0006810 transport No
GO:0043227 membrane-bounded organelle No
GO:0051179 localization No
GO:0050658 RNA transport No
GO:0043231 intracellular membrane-bounded organelle No
GO:0043229 intracellular organelle No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 14 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|3750
MAPRGPRSSASTRQAKSTTKASTRAGITKHRGPTRADIDGDIDMDAPTRASNRSTADGAGNRRVSALQASRNTRA
LPRNPRREIIATLASRVTDPSQLRAKPGFAVLRVHGLSQSKAASNPDGGLEDLIAFLKRKASSFVNGPSRRHIGI
QKCHRAGDYVYITASKRDAEELVKINKFQFAGTALEVVAMNQDAVTEPPCPIPQHGPDFRDLNGVGESFLLDFFA
MFDSDRQGLISRFYDKDSTFSLAVDTQSIRDTNAPAPLPWSAYLKFSRNLLRITHRNARIQRLFKGANVIYELWA
NLPLTRHPDVKSSFDKYIFDCHPVDGLANPNGPPHSNVSGLTVSAHGEFDESDTQTHSGGKRSFSRTFVLGPGQN
GQGAIRVVSDVLMLRAYNALPDVSAAPTANAVTNGNQHDAMIVELSKQTGMLPEYSKMCLEQVDWQFEKALPLFL
EKKGQLPADAFA*
Coding >OphauG2|3750
ATGGCGCCTCGGGGTCCGCGATCGTCGGCGAGTACTCGCCAGGCCAAGAGCACCACAAAGGCCAGCACGAGAGCT
GGTATCACCAAGCACCGAGGCCCTACAAGAGCAGATATCGATGGCGACATTGACATGGACGCACCCACAAGGGCG
TCCAACAGATCTACGGCTGATGGCGCCGGAAACCGGCGTGTCTCTGCCTTGCAAGCCTCCCGAAACACACGAGCC
TTGCCTAGGAACCCAAGGCGTGAGATTATCGCCACTCTTGCCTCACGAGTCACGGATCCTTCACAACTACGAGCA
AAGCCTGGTTTTGCCGTATTGCGAGTCCATGGCTTGAGTCAAAGCAAGGCGGCCAGCAACCCGGACGGAGGCCTC
GAGGATTTGATCGCCTTTCTAAAGCGTAAAGCCTCTTCCTTTGTCAATGGGCCATCGAGACGGCACATTGGCATA
CAAAAGTGTCACAGGGCCGGGGACTACGTATACATTACAGCATCCAAGCGTGACGCCGAGGAACTCGTCAAGATA
AACAAGTTTCAATTCGCCGGCACTGCTCTGGAAGTTGTCGCGATGAATCAAGATGCCGTGACCGAGCCGCCTTGT
CCAATCCCTCAACATGGTCCCGACTTTCGAGACCTTAACGGGGTCGGCGAGAGCTTTCTGCTCGATTTCTTTGCC
ATGTTTGATTCGGATCGTCAGGGGTTGATTTCACGCTTCTACGACAAGGACAGTACCTTTTCACTCGCCGTCGAC
ACACAGTCCATCCGGGATACTAACGCGCCAGCCCCTTTGCCCTGGTCGGCGTACCTCAAGTTTTCACGAAACCTT
CTCAGAATCACGCACCGGAATGCCAGGATTCAGCGACTTTTCAAAGGGGCCAATGTCATCTACGAATTGTGGGCC
AACCTGCCACTGACGAGACATCCAGACGTCAAGTCAAGTTTTGACAAGTACATATTCGACTGTCATCCCGTAGAC
GGCCTGGCGAACCCCAACGGCCCGCCACATTCCAACGTTTCGGGCTTAACAGTATCTGCTCACGGGGAATTTGAC
GAGAGCGATACGCAGACTCACTCGGGAGGGAAGCGAAGTTTTTCGCGTACTTTTGTCCTTGGGCCCGGCCAGAAC
GGTCAGGGAGCTATTCGAGTCGTCAGCGATGTGCTCATGTTGCGAGCCTACAATGCGCTGCCCGATGTGTCTGCG
GCTCCTACGGCAAACGCCGTAACAAATGGCAACCAGCATGACGCCATGATTGTTGAGCTGTCGAAGCAGACGGGA
ATGCTGCCAGAGTACAGCAAAATGTGCTTGGAGCAGGTGGATTGGCAGTTTGAAAAGGCCCTGCCTTTATTTCTT
GAGAAGAAGGGACAACTTCCCGCCGACGCGTTCGCCTAG
Transcript >OphauG2|3750
ATGGCGCCTCGGGGTCCGCGATCGTCGGCGAGTACTCGCCAGGCCAAGAGCACCACAAAGGCCAGCACGAGAGCT
GGTATCACCAAGCACCGAGGCCCTACAAGAGCAGATATCGATGGCGACATTGACATGGACGCACCCACAAGGGCG
TCCAACAGATCTACGGCTGATGGCGCCGGAAACCGGCGTGTCTCTGCCTTGCAAGCCTCCCGAAACACACGAGCC
TTGCCTAGGAACCCAAGGCGTGAGATTATCGCCACTCTTGCCTCACGAGTCACGGATCCTTCACAACTACGAGCA
AAGCCTGGTTTTGCCGTATTGCGAGTCCATGGCTTGAGTCAAAGCAAGGCGGCCAGCAACCCGGACGGAGGCCTC
GAGGATTTGATCGCCTTTCTAAAGCGTAAAGCCTCTTCCTTTGTCAATGGGCCATCGAGACGGCACATTGGCATA
CAAAAGTGTCACAGGGCCGGGGACTACGTATACATTACAGCATCCAAGCGTGACGCCGAGGAACTCGTCAAGATA
AACAAGTTTCAATTCGCCGGCACTGCTCTGGAAGTTGTCGCGATGAATCAAGATGCCGTGACCGAGCCGCCTTGT
CCAATCCCTCAACATGGTCCCGACTTTCGAGACCTTAACGGGGTCGGCGAGAGCTTTCTGCTCGATTTCTTTGCC
ATGTTTGATTCGGATCGTCAGGGGTTGATTTCACGCTTCTACGACAAGGACAGTACCTTTTCACTCGCCGTCGAC
ACACAGTCCATCCGGGATACTAACGCGCCAGCCCCTTTGCCCTGGTCGGCGTACCTCAAGTTTTCACGAAACCTT
CTCAGAATCACGCACCGGAATGCCAGGATTCAGCGACTTTTCAAAGGGGCCAATGTCATCTACGAATTGTGGGCC
AACCTGCCACTGACGAGACATCCAGACGTCAAGTCAAGTTTTGACAAGTACATATTCGACTGTCATCCCGTAGAC
GGCCTGGCGAACCCCAACGGCCCGCCACATTCCAACGTTTCGGGCTTAACAGTATCTGCTCACGGGGAATTTGAC
GAGAGCGATACGCAGACTCACTCGGGAGGGAAGCGAAGTTTTTCGCGTACTTTTGTCCTTGGGCCCGGCCAGAAC
GGTCAGGGAGCTATTCGAGTCGTCAGCGATGTGCTCATGTTGCGAGCCTACAATGCGCTGCCCGATGTGTCTGCG
GCTCCTACGGCAAACGCCGTAACAAATGGCAACCAGCATGACGCCATGATTGTTGAGCTGTCGAAGCAGACGGGA
ATGCTGCCAGAGTACAGCAAAATGTGCTTGGAGCAGGTGGATTGGCAGTTTGAAAAGGCCCTGCCTTTATTTCTT
GAGAAGAAGGGACAACTTCCCGCCGACGCGTTCGCCTAG
Gene >OphauG2|3750
ATGGCGCCTCGGGGTCCGCGATCGTCGGCGAGTACTCGCCAGGCCAAGAGCACCACAAAGGCCAGCACGAGAGCT
GGTATCACCAAGCACCGAGGCCCTACAAGAGCAGATATCGATGGCGACATTGACATGGACGCACCCACAAGGGCG
TCCAACAGATCTACGGCTGATGGCGCCGGAAACCGGCGTGTCTCTGCCTTGCAAGCCTCCCGAAACACACGAGCC
TTGCCTAGGAACCCAAGGCGTGAGATTATCGCCACTCTTGCCTCACGAGTCACGGATCCTTCACAACTACGAGCA
AAGCCTGGTTTTGCCGTATTGCGAGTCCATGGCTTGAGTCAAAGCAAGGCGGCCAGCAACCCGGACGGAGGCCTC
GAGGATTTGATCGCCTTTCTAAAGCGTAAAGCCTCTTCCTTTGTCAATGGGCCATCGAGACGGCACATTGGCATA
CAAAAGGTTAGCTGAATCCCCCCAATGCTTAGATTGACGCCTACTTAGCAGCTCGCCTCCAAGTGTCACAGGGCC
GGGGACTACGTATACATTACAGCATCCAAGCGTGACGCCGAGGAACTCGTCAAGATAAACAAGTTTCAATTCGCC
GGCACTGCTCTGGAAGTTGTCGCGATGAATCAAGATGCCGTGACCGAGCCGCCTTGTCCAATCCCTCAACATGGT
CCCGACTTTCGAGACCTTAACGGGGTCGGCGAGAGCTTTCTGCTCGATTTCTTTGCCATGTTTGATTCGGATCGT
CAGGGGTTGATTTCACGCTTCTACGACAAGGACAGTACCTTTTCACTCGCCGTCGACACACAGTCCATCCGGGAT
ACTAACGCGCCAGCCCCTTTGCCCTGGTCGGCGTACCTCAAGTTTTCACGAAACCTTCTCAGAATCACGCACCGG
AATGCCAGGATTCAGCGACTTTTCAAAGGGGCCAATGTCATCTACGAATTGTGGGCCAACCTGCCACTGACGAGA
CATCCAGACGTCAAGTCAAGTTTTGACAAGTACATATTCGACTGTCATCCCGTAGACGGCCTGGCGAACCCCAAC
GGCCCGCCACATTCCAACGTTTCGGGCTTAACAGTATCTGCTCACGGGGAATTTGACGAGAGCGATACGCAGACT
CACTCGGGAGGGAAGCGAAGTTTTTCGCGTACTTTTGTCCTTGGGCCCGGCCAGAACGGTCAGGGAGCTATTCGA
GTCGTCAGCGATGTGCTCATGTTGCGAGCCTACAATGCGCTGCCCGATGTGTCTGCGGCTCCTACGGCAAACGCC
GTAACAAATGGCAACCAGCATGACGCCATGATTGTTGAGCTGTCGAAGCAGACGGGAATGCTGCCAGAGTACAGC
AAAATGTGCTTGGAGCAGGTGGATTGGCAGTTTGAAAAGGCCCTGCCTTTATTTCTTGAGAAGAAGGTTTGATAC
CCATTATTTCCTGTGTTTACGCGGTTATTTGTCTGACATGGTTCAAGGGACAACTTCCCGCCGACGCGTTCGCCT
AG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail